KEGG   Burkholderia pseudomallei MSHR305: BDL_489Help
Entry
BDL_489           CDS       T02756                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00072  Synthesis and degradation of ketone bodies
bpse00280  Valine, leucine and isoleucine degradation
bpse00650  Butanoate metabolism
bpse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BDL_489
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BDL_489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDL_489
Enzymes [BR:bpse01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BDL_489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: AGR73157
Position
2:complement(605660..606364)
Genome map
AA seq 234 aa AA seqDB search
MNKVYPSAAAALEGVVHDGQTFAVGGFGLCGIPEALIAALRDSAVKGITCISNNAGVDGF
GLGLLLETRQIKKMISSYVGENKEFERQYLSGELELEFTPQGTLAEKLRAGGAGIPAFFT
QTGYGTVIAEGKETREFDGKHYVLEPSLTADVALVKAWKADKSGNLVYRRTARNFNPMCA
MAGRITIAEVEEIVENGELDPDAIHTPGIFVQRLVLNATPEKRIEQRVVRAKGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagtctacccaagcgcggctgccgcgctcgagggcgtcgtccatgacgggcag
accttcgcggtcggcggcttcggcctgtgcggcattccggaagcgctcatcgccgcgctg
cgcgattcggcggtgaagggcatcacctgcatcagcaacaacgcgggcgttgacggcttc
ggccttggcctgctgctcgaaacccggcaaatcaagaagatgatctcgtcgtacgtcggc
gagaacaaggagttcgaacgccagtatctgtcgggcgaactcgagctcgagttcacgccg
cagggcacgctcgcggagaagctgcgcgcgggcggcgcgggcatcccggcgttcttcacg
cagacgggctacggcaccgtgatcgccgaaggcaaggagacgcgcgagttcgacggcaag
cattacgtgctcgagccgtcgctcacggcggacgtcgcgctcgtgaaggcttggaaagcc
gacaagtcgggcaacctggtttaccggcgcaccgcgcgcaacttcaatccgatgtgcgcg
atggcgggccggatcacgatcgccgaggtcgaggagatcgtcgagaacggcgagctcgat
ccggatgcgatccacacgcccggcattttcgtgcagcggctcgtgctcaacgcgacgccg
gaaaaacgcatcgaacaacgcgtcgtgcgcgcgaaaggagactga

DBGET integrated database retrieval system