KEGG   Burkholderia pseudomallei MSHR305: BDL_5162Help
Entry
BDL_5162          CDS       T02756                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00900  Terpenoid backbone biosynthesis
bpse01100  Metabolic pathways
bpse01110  Biosynthesis of secondary metabolites
bpse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDL_5162
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bpse01006]
    BDL_5162
Enzymes [BR:bpse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BDL_5162
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BDL_5162
Prenyltransferases [BR:bpse01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BDL_5162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGR68500
Position
1:complement(2114015..2114899)
Genome map
AA seq 294 aa AA seqDB search
MTFDQWMRSVLERVETALGHYLPAGTVAPAQLHEAMRYAVLGGGKRVRPLLCHAAGELTG
ASEAARDAASAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVKYDEPTALLVGDALQSQ
AFVALTDAAALPADRQAALVRELALASGSIGMAGGQAIDLASVGVALTRDALETMHRMKT
GALLRASVRMGALAGETPSGDAMRALDAYAAAVGLAFQVVDDILDVTTDSATLGKTAGKD
AANDKPTYVSIIGLDASRALAAQLRADAHAALEPFGARAQRLAELADLVVNRVS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaccaatggatgcgctcggtgctcgagcgtgtcgagacggccctcggccat
tatttaccggccgggactgtggcgcccgcgcaactgcacgaagcgatgcgctatgcggtg
ctcgggggcggcaaacgcgtgcgtccgctgctgtgccatgcggcgggcgagctcacgggc
gcgtcggaggcggcgcgtgacgcggcgtcggctgcgctcgagatgattcacgtgtattcg
ctcgtgcatgatgatatgccgtgcatggatgacgacgcgctgcgtcgcggcaagccgacc
gtccacgtcaagtacgacgagccgaccgcgctgctcgtcggcgacgcgctgcagtcgcag
gctttcgtcgcgctgaccgacgccgccgcgctgccggccgaccggcaggcggcgctcgtg
cgcgagctcgcgctcgcgagcggctcgatcggcatggcgggcggccaggcgatcgatctc
gcgagcgtcggcgtggcgctcacgcgcgacgcgctggagacgatgcatcggatgaagacg
ggcgcgctgttgcgcgcgtcggtgcgcatgggcgcgctcgcgggcgagacgccgtccggc
gacgcgatgcgcgcgctcgacgcctatgcggcggccgtcggcctggcgttccaggtggtg
gacgacattctcgacgtcaccaccgattccgcgacgctcggcaagacggccggcaaggac
gcggcgaacgacaagccgacctacgtgtcgatcatcggtctcgacgcgtcgcgcgcgctt
gccgcgcaattgcgcgccgatgcgcacgccgcgctcgagccgttcggcgcgcgcgcgcag
cgcctggccgaactggcggacctggtggtgaaccgggtcagctga

DBGET integrated database retrieval system