KEGG   Burkholderia pseudomallei MSHR305: BDL_5566Help
Entry
BDL_5566          CDS       T02756                                 

Definition
(GenBank) intracellular multiplication and macrophage-killing family protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_5566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_5566
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_5566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AGR70029
Position
1:complement(2582194..2585823)
Genome map
AA seq 1209 aa AA seqDB search
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFV
AWGARIAWRGWRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVR
FGEADGARKGLPRWLEQMSRQYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAA
IRGVGGTRHCDWWFTNDAVLIDTAGRYTTHESNRALDEAEWKGFVDLLKKYRARQPLNGA
MLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFPVYLLVTKADLLAGFAEYFGG
FGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLASQTDARQREM
TYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLC
VAVLFAWLRSYSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAG
GVDLRHPPLAYRWGLFQGEKIEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYA
YAALKAYLMLYDSAHYDPAFVQAVVDLEMERALPADFSSAQRSALRAHLGALFGNRVAVS
PFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASYDFSVARAVGPDASLVFRRQS
GKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNPADAAAWARDI
RQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAP
GGGDQAASFDAVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVL
DDLSNVANGSIASVEQRNVAQRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAA
GGLMDDFFQKNLQTLVDTTAHPWRFNNRNAEADPSAAAMLGSFEKAAVIRDVYFGGGART
AQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAVQWPGTRGSNQVRLQVTEQSG
ATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASSVRNPFRLPQM
ESFTCPPKQ
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgctgtcgcacgcatcgttcgcccgctgccgtcgcgggacatctggacgttc
gccggcctcgtcgtgctggcgtgtttcgtttggcttgccgggccgctgttcgcgttcgcc
gagttccgcccgttcgagagcggcgcggtgcgcgcggcgacgatcgtcgcgctgttcgtc
gcgtggggcgcgcggatcgcgtggcgcggctggcgcgcggggcaactgaacgcgcagttg
ctcaaccagttgcgcgaagcggcgccgcggcccgccgcgacgggcgatcccgcgcaggcg
cagctcgacgagctgcgcagccgcttcgacgaagccgcgacgctgttgaagaaagtccgt
ttcggcgaagccgacggcgcgcgcaagggcctgccgcggtggctcgagcagatgtcgcgc
cagtatctgtaccaactgccgtggtacgtgttcatcggcgcgccgggctcgggcaagacg
acggcgctcgtcaactcggggctgagctttccgctcgccgagcagttcgggcgcgcggcg
attcgcggcgtcggcggcacgcggcactgcgactggtggttcacgaacgacgcggtgctg
atcgacaccgcgggccgctacacgacgcacgagagcaaccgcgcgctcgacgaggccgaa
tggaagggcttcgtcgatctgctgaagaagtaccgcgcgcgccagccgctgaacggcgcg
atgctgacgatcagcgtcgccgatctgctcggcgcgtcggaggcggagcgcacgcagcac
gcgatggtgctgcgcaagcgcctgctcgagctgcgcgcgcagctcggcatccgctttccg
gtgtatctgctcgtgacgaaggcggacttgctcgccggcttcgccgaatacttcggcggc
ttcggccgcgccgaatgcgcgcaggtgtggggcttcacgttcccgctcgccgagagcgaa
gcgcccggcttcgagctgcgcgcggcgttcgaccgcgaataccggctgctgcaccagcgg
ctgaacgacgggctgccggagctgctcgcatcgcagaccgacgcgcgccagcgcgagatg
acctacctgctgccgcagcagatcgccgatctgcaggacatgctcggccagttcgtcgcc
gaggtgttctcggtgtcgagcttcgagccgatgccgatgctgcgcggcgtctatctgacg
agcggcacgcaggaaggcaccgcgttcgaccgcgtgatgagcgggatcaagcgcttcctg
aagatcgagggcgtgccgcccgccgcgcagacgggctcgtcgggccgcagtttcttcctg
aaatcgctgctgcaggatcacatctttcgcgaggcggcgcttgccggcagcaatctgcgc
tggcatcagcggcagcgtgcgctgcagatcgtcggctacgcggcgatcgcgctgctgtgc
gtggcggtgctgttcgcgtggctgcgcagctactcgcgcaatcgcgactatctcgacgag
gtcgccgcgcgcgtgccggcggtcgacgcgcagatcggccgcgcgaaattcacgggcgca
gccgacatcgtgcagctgctgccggtgctcgacgagctgagcggcctgccgaacgcgggc
ggcgtggacttgcggcatccgccgctcgcgtatcgctggggcctgttccagggcgagaag
atcgaggaggcgagcgacgccgtctaccggcgcgcgctcgacgacgtgctgctgccgatc
gccgcgagccggatggagcaggcgctgcgcgacgcgcggcccgacgaggtcgagtatgcg
tacgcggcgctcaaggcgtacctgatgctttacgacagcgcgcactacgatcccgcgttc
gtgcaggccgtcgtcgatctcgagatggagcgcgcgctgccggccgatttctcgtccgcg
cagcgcagcgcgctgcgcgcgcatctcggcgcgctgttcggcaatcgcgtcgcggtgtcg
ccgtttccgatgaacgagcggctcgtcgccgacgtgcgcgagcggctgcggcaggtgccg
ttctcgcagcggctgtatcggcagctcgcgcgcacgctgcacgcgagcaccgcgtcgtac
gatttcagcgtcgcgcgcgcggtggggccggacgcgtcgctcgtgttccggcggcagagc
ggcaagagcctcgccgacggcgtgccgggcctctacacgcgcagcggctaccgcaacgtg
ttcgcgccgcgtctgcccggcgcgatcgattcgtacgggcgcgaggaggtgtgggtgctg
aacctcggcgcgtccgagatcccgaatccggccgacgcggccgcctgggcgcgcgacatc
cggcagctctacctgaacgactacatcaagacctgggacgactatctggccgacatccgg
ctgcagcgcacgtcgacgctcgcgcagagcatccaggtcgcgcgcacgttgtcgtcggcc
gattcgccgctcacgcggctgatggtcgcgctcgcgcgcgacacgccgctcggcgatgcg
cccggcggcgcgcgcaatctcgcgtcgcgcgcgcaggacaaggtcgacgaggcgcgcaac
tcgctcgcgcagatcttcgccgggcagccgggcggcgaagcgggcgcggcggccgcgccg
cccgcgagccccgagcagatcgtcgacagccacttcgcggggctgcgcgcgttcgcgccg
ggcggcggggatcaggcggcgtcgttcgacgcggtgctcaaggcgatcgacgcgctgtac
acgtacctcaccgcgaccgacgacgcattgcgcagcggcgcggcgccgccgccgtcggac
gcgcccgcgcggctgcgcgcgcaggcgggccggttgccgacgcctgtgcgcgaggtgctc
gacgatttgtcgaacgtcgcgaacggcagcatcgcgagcgtcgagcagcgcaacgtcgcg
cagcgcgcgggcgcgaacgtcggcgatttctgccggcaggcgatcgccgggcgctacccg
ttcgcgcgcggcgcggcgcgcgacgtcgcgccgtccgatttcgcgcagctgttcgcggcg
ggcggcctgatggacgacttcttccagaagaacctgcaaacgctcgtcgacacgaccgcg
catccgtggcgtttcaacaaccgcaacgccgaagccgacccgtcggcggccgcgatgctc
ggctcgttcgagaaggcggcggtgatccgcgacgtctatttcggaggcggcgcgcggacc
gcgcagatcaaggtcgagatcgtgccgctcgaaatggacccgtcgatctcggagatgctg
ctcgacgtcgacggccagatcgtccgctacgcgcacggtccgcaggtgccgacggcggtg
cagtggcccggcacgcgcggcagcaatcaggtgcggctgcaggtgaccgagcagtcgggg
gcgacgggcggcttcacgaccgagggcccgtgggcgctgcaccggctgttcgaccgtgcg
ggcgtgtcgggtgggcgcgggcccgagcagatggtcgcgagattcgcggtcgacggcaag
ccgatcgtgctgcaggtgacggcgagcagcgttcgcaacccgttccggttgccgcagatg
gagtcctttacatgtcctccgaagcaatga

DBGET integrated database retrieval system