KEGG   Burkholderia pseudomallei MSHR305: BDL_5571Help
Entry
BDL_5571          CDS       T02756                                 

Definition
(GenBank) FHA domain protein
  KO
K07169  FHA domain-containing protein
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BDL_5571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AGR69435
Position
1:2590172..2591608
Genome map
AA seq 478 aa AA seqDB search
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDA
CLLKNLSSVSTIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATAA
AAAAPAASAAQAQAKGAGNKLWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPR
DLNQLSTDPLDLFAQPHGDPDARAGAVREGEDRAPPTVTQPDHAPEWTQHVRVQPAQSAP
PAASRPGAPAARSGDIPAADDASDMPSRVRASPAPAPATPETLLQAFFEGAGLDTTAEQH
HWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLKLLPDGSAVL
RQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaccgttatcgaacacgcgggcgagccggtcggcaccgacggccgcaacgcc
gtcgtgtttcatgcgccgggcggcaccatcggccgggacagcgacaatcacctcgtgctg
cgcgacgacacccggcaaatctcgcgcctgcaggcgctgctgcaggtggccgacgacgcg
tgcctgctgaagaacctgagcagcgtatcgacgatcgaagtgaaccgcgtgccgatcggc
tacgcgcaggcgcagcgcctgaacatgggcgacatcatccggatcggcccttacctgctg
cgcgcggagcccgacgacgcgacgatcgagcgaaccgtcgaagccgccgccacggcggcc
gcggcggcggcgccggcggcgtccgccgcgcaggctcaggcgaagggggcgggcaacaaa
ctgtggggcctgctgcacgagcgcttcgggctcggcaaggcacagggcgcgggcgagcag
tccggcgcgcgtgccgcgccggcgcgccaccacgattcgccggcgtccgccgcgccgcgc
gacctgaatcagctgtcgaccgatccgctcgacctgttcgcgcagccgcacggcgatccg
gatgcgcgagccggcgccgtgcgcgaaggcgaagaccgcgcgccgcccaccgtcacgcaa
ccggatcacgcgcccgagtggacgcaacacgtccgcgtgcagccggcacaatccgcgccg
cccgccgcctctcgccccggcgcgcccgccgcgcgttcgggcgatatccccgcagcggac
gatgcgagcgacatgccgtcgcgcgtgcgcgcgtcgccggcccccgcgccggcgacaccc
gagacattgctgcaggcgttcttcgaaggcgcggggctcgacaccaccgccgagcagcat
cactggtccgccgagcagttgttcgtcgcggggcaactgctcgcgctgttcgccaacggc
acggtcgagctgctgtcgtcacgcagcatcctgaagcgcgaagtgaaggccgacatgacg
atgctgctcgaccgcgagaacaatccgctgaagctgctgccggacggcagcgcggtgctg
cgccagatgttcgggctgccgctgccgggcttcatgacaccgcaaagcgccgtgtccgac
gcgttccaggatctgcacgcgcaccagatcggcatggtggccggcatgcgcgccgcgctg
atggatctgctcacgcgcttctcgccgcagcgcctgcgcgagcgcgacgccgcgccccag
tggtacgagaagcgcgtgccggcgctgtacaaggcgcgcctctgggaccgctatgcaacc
acgcatcgcgacacgctgttcgcgatcgaggacgatttcgcctccgtgttcggcaaggcg
ttcctcagcgcctacgacgcggaagtcgagagctatcgcggacgctgccgccggtga

DBGET integrated database retrieval system