KEGG   Burkholderia pseudomallei MSHR305: BDL_577
Entry
BDL_577           CDS       T02756                                 

Definition
(GenBank) hypothetical protein
Organism
bpse  Burkholderia pseudomallei MSHR305
SSDB
Motif
Pfam: DrsE MIS13 DUF3742
Other DBs
NCBI-ProteinID: AGR72601
Position
2:complement(716460..719483)
AA seq 1007 aa
MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLRE
GFVYLLYESGPRGPFHWEVYSVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLV
IEKPHQCGNVWIAFSEWPWSQDTVKRYGGNDANAASLRKKRMQLIEPSTWISAPKPGPYS
APLTEANLQRVIEHAPAIATTAKGEPVGLLSAELPEAVSYGDVGAFRDARLQICTSRYPW
AMRNKAAAGAKLSSAAETVKGAQGSTRNTKGEPCVPLMVALWDGIGITHELNGFRNDAQA
RFLQYCDEQALRINALQWIDQAKLAVEAGARRKATFDHSPAMPGSTSWYYPDAVAKQKAA
AKAPADRQFWNDYQWMGENGVPPSYARQITQFRAAPSSPAYQDAMARARKYVEAKPRIEQ
DRAKKIDQDTVTGAEHDWAKYREKLADDTSSKKGASNGNVKRIDVFRVLYQRIQDQKQAL
LAQRTADVASWLDAPLFLSALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLI
DRLDPTKPESLVWRMVASNQKKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLK
KFAEFYTKMDEMSKQAKQLNAIDQAMHDKGVDKVVVSVGHLVFQRFPYKGADLAGLGNGV
SEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLGEYQTQRRMGRSSPEAFRMAT
SAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEGRDWAELGGAC
FSVAGAAAEVALKPLETLKFEQGAKNVKILGGYCGAIAGGIGMVFDLMDARGKWKNGEQL
VGLLYVGKGILGFGATVAFGLTALSSSAPFFERIASNVTGRKIRIVVLDRVGQGIVDAAA
RKAAIAAGQEAAAVAAERAGAMVVGRVLLFMASWEIQVAVIAIQVVIWALSNDDLQNAML
DSVFGMERKYKVVADLKRQDEAFDKALVAVGFKSEETDEKGKAGQNG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggcgggaagcgacgatcgttgcgacgtttgcaagcttcaggggctggcggtctatccg
tcgcgctacgcggtggtgccaaaaaccttcgacgcgccagcgctcggaccattcgacgac
aagagcgtcacgggcgtggcgctcacgcaaagcaagtacggcttgcgtcaactccgcgag
ggcttcgtctatttgctctacgaatcgggcccgcgcggcccgtttcattgggaagtgtat
tcagtcgcgccggacggcacgctctggaagcagctggatacggcgagcgtgaagcgggtg
agcgctccacaggcttgtcagcgaaaggggcatagcgcgtcgcgtgtccagtatctcgtc
atcgagaaaccacatcagtgcggcaatgtctggatcgcgttcagcgaatggccatggagc
caagacacggttaagcgttacggcggcaacgacgcgaacgccgccagtctgcgcaagaaa
cgcatgcaactcatcgagccttcgacgtggatatccgcgccgaagccgggaccgtattcg
gcgccgctgaccgaagccaatctgcagcgcgtcatcgaacatgcgcccgctatcgcgacc
acggcgaaaggcgaacccgtcggcctgctcagcgcggagctgccggaggcggtcagctac
ggggacgtgggcgcgtttcgcgacgctcgcctgcaaatttgtacgtcgcgttacccgtgg
gccatgcgcaacaaggctgcggcgggtgcaaagcttagttccgcggcagaaacggtcaag
ggcgcgcagggcagtacccgaaacacaaagggtgagccgtgcgtgccgttgatggtggct
ctgtgggacggcatcgggatcacgcacgaactgaacggcttccgtaacgatgcgcaggcg
cgttttctgcagtattgcgacgagcaggcgctccgaatcaatgcgctgcagtggattgat
caggcgaagctcgcggtggaagccggtgcgcgcagaaaggcgacgttcgatcatagtccg
gccatgccgggcagtacgagctggtattacccggatgccgttgcgaagcaaaaggcggcc
gcgaaggctccggcggatcggcagttctggaacgattatcagtggatgggggaaaacggc
gtaccgccgtcatacgccagacagatcacgcagtttcgcgctgcgccgtcatcgccggcc
tatcaggatgcgatggcgagagcgcgcaagtatgtcgaggccaagccgagaatcgagcag
gatcgcgcgaagaagatcgaccaggacacggttaccggagccgagcacgattgggcgaag
taccgcgagaaattggcggacgatacgtcgagcaagaaaggggcgtccaatgggaacgtc
aaacgtatcgacgtttttcgcgtcctgtaccagcgtatccaggaccaaaagcaggcgttg
ctcgcgcagcggacagcggatgtcgcgagctggctggatgcgccgctttttctgtcggcg
ctggaggattatcacgaagagaacggcttcgacgggattgcgttcgagtttgccattttc
catgcgatcgtcggattgagcgccgagcgaagcggcgtggccgcattgaacaagctgatc
gatcgcctggatccgacgaagccggagagcctcgtttggcgaatggtggcgagcaaccag
aagaaatcgaaggaagcgctgaagctcgcgctcgcgaaggcggaggcgaacaagaacgtc
gtactggagacggtcggcgaaggattcaacgtattcgcggaaacgtccgaaaagctgaag
aagttcgccgagttttacacgaagatggacgaaatgagcaagcaggccaaacagctcaac
gccattgatcaggcaatgcacgacaagggcgtcgacaaggtggtcgtcagtgtcgggcat
cttgtttttcagcgctttccgtacaagggggccgatttggcgggccttggaaacggcgtg
agcgaggcgatcatcaagtccgtgttcatgctgcgggtcggcatcaagagcgaagaggtg
aaggatctcgtcttgcagcaagccaaggtggagccgcagcttcggagcaagttcctcgga
gagtaccagacgcagcgccgaatgggacgcagttcgccggaagccttccggatggccacg
tcggctgttgccaagaccgaaggctcgaacgtgctggccaatcggtggagcaagctcaag
gtgcgcgagagtgtcggccttgtgggcgtgatcgggctgatcgaagtgatcgggttgatc
aagctgattaacaagagcgacaaggaagggcgggattgggctgaattgggcggcgcatgt
ttttcggtggcgggcgctgcggcggaggttgcgcttaagcccttggagacgctcaaattc
gaacagggggcgaagaacgtcaagatacttggtgggtactgcggagcgattgcgggaggc
atcggaatggtattcgatttgatggatgcgagggggaaatggaaaaacggcgaacagtta
gttggtcttctttatgtaggtaagggcattctcggattcggcgccacggtggcatttggt
ttaaccgctttgagttcatccgcgccattcttcgagcgcatcgcatcgaatgttactggc
cgaaaaattcgtatcgtcgtcctcgatcgtgtcgggcaaggcattgtcgatgcggcggcg
cgcaaggcagccattgctgcaggtcaggaagccgcagccgttgctgcggaacgggctgga
gccatggtggtgggcagggtgcttttgtttatggccagttgggaaattcaggtcgccgtt
atagctattcaagtcgtgatttgggcgctaagcaatgatgatttgcagaacgccatgctc
gattcggtgtttgggatggagcggaaatataaagtagtagctgatttgaagaggcaagac
gaggccttcgataaggcgttagtagcagttggcttcaagtctgaagagacggatgaaaaa
ggtaaggcagggcaaaacgggtag

DBGET integrated database retrieval system