KEGG   Burkholderia pseudomallei MSHR305: BDL_5941Help
Entry
BDL_5941          CDS       T02756                                 

Definition
(GenBank) Rhs element Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_5941
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_5941
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_5941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD
Motif
Other DBs
NCBI-ProteinID: AGR67653
Position
1:3037775..3040528
Genome map
AA seq 917 aa AA seqDB search
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFH
VPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYN
VYRIELRPWLWLATLTSDYKIFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARN
EPRAFQVQYGETDFDFVQRLMEEWGIYWFFEHSDNKHRLVLCDHIGGHRKAPSEAYHEIA
HHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLASLVTSNHQPRETNWGEGELFE
WPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHKHDGANREYLV
IESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNG
DPDRPLILGSLYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQ
AEKDMNRLTKNDESHTVGANFSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGA
YALNVGGAHAVAVGGASSVSVGGAYARNVGGAYALTVGGVLSIVCGASSITMTACGSIKI
VGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGGAIPPIPLPSFFLDITKPILP
PPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPRRRATRPRPRPRRRPTPTPTPTP
TPRQRQRQRQRRRPRRRPRPRQRQRRRRRQRRRRRPRRRRRRRRRPRRRRRRRRRPRPRQ
RQRRRQRRRRRRRQRRRQRQRQRRLVPRFKQCPLAPCKAPTFRGSPSHSSESFEHDNPGS
KSGRCDRTWRRSRHRLR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccatttttcgaacggacggacgaatcaaagccgcacggtagtgatccgcagc
ggtgcgatgccgcggctgctcggtcagcccgcgctcgagttcctgtcgctgcgcggtgaa
gagcacctcggaaaactctacacgtacgaattgctcctgcgcacgccggacgattttcat
gtgccgttggcaacgagcgcgaatctcgacctgaaggcgatgatcggcacggagatgacg
gtctgcattcagctcgacggaatcgggacgggcgcgcaaggcggcgttggcgcgggtgcg
cgcgaaatcagcgggctcgtggtcaaggcgggcttcctgcgctgcgaggggcgctacaac
gtctatcgcatcgagctgcgcccctggctgtggctcgcgactctgacgagcgactacaag
atttttcaggacaagagcgtcgtcgaaatcatcgatacggtcttgcacgattacccttac
ccggtcgagaagcggctcgacatcgacaagtattcggtggcgggcgagagcgctcgaaac
gagccgcgcgcgttccaggtgcaatatggcgaaaccgacttcgacttcgttcagcgtttg
atggaggagtgggggatctactggttcttcgagcattcggacaacaagcatcgcctggtc
ttgtgcgatcacatcggcggacatcgcaaggcgccgagcgaggcctatcacgagatcgcg
catcacccggaaggcgggaagatcgacatcgagtacatcaactatttctcgacggacgaa
gcgctgcggcccggccgcgtcgtgatagacgatttcgacttcacgcgtccgctcgcgagc
ctcgtcacgtccaatcaccagccgcgggagacgaactggggggagggcgagctgttcgaa
tggccgggcgactataccgatagcaagcatggcgatctcatcagccgcgtgcgcatggaa
gagcgccgcgcgaccgggtcgcgcgcgtacggtcggggcaacgtgcgcggcctcgcctgc
ggtcatacgttcgtgctgtcgaagcacaagcacgacggcgcgaaccgcgagtacctcgtc
atcgaatcggcgttgatgctgaccgaagtcgcggacgaaacgggcagcggctaccgctac
gaatgcgataacgaactggtcgtgcagccgtcgaacgaggtgtttcgaatgccgcgcgaa
acgcccaagccgacgacgagcgggccacagtccgcgatcgtggtcgggccgccgggccac
gaggtatggaccgacgaattcggccgcgtgaagatccgttttctgtgggatcgctacgca
cgcaatgatgcaacggattcctgctgggtacgcgtgagccaggcgtgggccggcgtgaac
ttcggcggcatctacattccgcggatcggacaggaagtgatcgtcggattcatgaacggc
gatccggaccgtccgctgattctcggcagcctctacaacaccattacgccgccgccttgg
gatctgcccggcgacgcgacgaagagcggattcaagagcaagtcgatcacgggcgggcgc
gagaactataacggcatccgcttcgaggacaagctgggggccgaggaatttcacatgcag
gcggaaaaggacatgaaccgcctgacgaagaacgacgagtcgcatacggtcggcgcgaat
ttttcgatcggcgtcgggcttacccatacgcgcgcggtgggcgccatgttcagcagcatc
gtcggcggagccgccagctatgcggtggggggcgcggaatcgacgatgatcggtggcgcg
tatgcgttgaacgtcggcggcgcgcacgcggttgcggtgggcggcgcgtcgtccgtttcc
gttggcggcgcctacgcgcgcaacgtgggcggcgcgtatgcgctgacagtcggcggcgtg
ctgtcgatcgtctgcggtgcgtcttcgatcaccatgacggcttgcggctcgatcaagatc
gtcggcaagaatattcgcatcatcggcagcgacgaagtcgtcgtgcaaggcgcgcccctg
cagctgaatccgggcgattcggattgcggcggagggggaggcggcggcggcggcggcggc
gcgattccgccgattccgttgccgtcgttcttcctcgatatcacgaagccgattcttccg
ccgccgccgccgccaccgacggaggtgccaccggatccgacgcccacgccgacgcccacg
ccgacgccgacgccgacgcccacgcccacgccgacgccaacgccgaccccacgccgacgc
gccacgcgcccacgcccacgcccacgccgacgccccacgcccacgccaacgcccacgccg
accccacgccaacgccaacgccaacgccaacgccgacgcccacgccgacgcccacgccca
cgccaacgccaacgccgacgccgacgccaacgccgacgccgacgcccacgccgacgccga
cgccgacgccgacgcccacgccgacgccgacgccgacgccgacgcccacgcccacgccaa
cgccaacgccgacgccaacgccgacgccgacgccgacgccaacgccgacgccaacgccaa
cgccaacgccgactagttccgagatttaagcaatgcccactggcgccatgtaaggcgcca
acattcagaggttcaccaagtcattcatcggagagttttgaacatgacaatcccggcagc
aagagtgggagatgcgatcggacatggcggcgttctcgtcaccggctcaggtga

DBGET integrated database retrieval system