KEGG   Burkholderia pseudomallei MSHR305: BDL_5949Help
Entry
BDL_5949          CDS       T02756                                 

Definition
(GenBank) lysozyme family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_5949
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_5949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AGR67826
Position
1:complement(3050576..3051094)
Genome map
AA seq 172 aa AA seqDB search
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLD
DEVDARRYPLVSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRP
LAAQPGASYNKLTFEISALVQWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatcctgagggacggcatcgggccgcctatcttccgtcgctgctcgaccggctg
caagacgacgcgccgcacgcgctcagcgaatcgcccgatgcctatgcgccgagcgccgac
gaaatgcgccgcatcgtgcagcgagacctgagcctgttgctgaacaccagcaatctggac
gacgaggtggacgcccgccgctatccgctcgtgtcggcatctgtcgtcaactatggcgtg
ccgcctttggcgggcagctatctgcacgaccggaaccgggaaacgatcgagcgcctcgtg
cgcaccgcgatcgcccacttcgagccgcgcctcattgcggactccttggcgatcaggccg
ctcgcggcgcaaccgggcgccagctacaacaaattgacgttcgaaatcagcgcgctcgtg
caatggtcgccgtatccgctggagttgcgcatccagagcacgttcgacctcgaattgaat
cgagtcacgctcgagaagacgacgctcaacggaaattga

DBGET integrated database retrieval system