KEGG   Burkholderia pseudomallei MSHR305: BDL_6058
Entry
BDL_6058          CDS       T02756                                 

Definition
(GenBank) intracellular multiplication and macrophage-killing family protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BDL_6058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_6058
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_6058
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AGR68943
Position
1:complement(3178916..3182992)
AA seq 1358 aa
MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLL
WLAGRPTSIVFVALLCVLIWHASPLLAFGGATPFAPEAVRAIAIALVLAAFALHLAFRLL
QKARTDPDFLKSLLEFGGKQPESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGK
RYLYELPWYVTLGSRACGKTSALLNAGLSFPVAAQMPRAAAGLPDHGGSVDWWLTNDAVL
IDTAGHYTRHGTSAHAAPLPPAGPAPHAQPFDAAADARRANGQPAGERHAVAMAAAAPSS
TAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTSADDNARHAEA
AALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQTWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDR
VFADSRYDDTQHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQE
TSQSFFLHDLLTKIVIPDARLVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGN
NDAYLDALARKTAALASRVDQLYKAPKPEAVPDVLTQARSLSAYPGLDLSAPGSGWRFGL
YTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIADRDPKAAYDALRVYLMLYDRA
RFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIRNDALIRQARA
FLDGSNATERLYERAKAAMDKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYL
IEYAQQWDAFLGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASAD
RSFLQKASAQLSQQADKALGVRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAG
KSGLDAVANLLNDYYTALTVSDDALANNSMPPANDTAAKLKMAAQTMPAPFRSVLTGLAA
QGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDSKHDVGIEDFTRVFAQGGVID
DFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWK
ADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKT
FRCPGSMPMFSLADTGAPPGLPPGSPAAPTSRVARDGR
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgaacaagttcctgtcctttctggtgtctcgatcgttcatcgcgttcgtcgcgctgctc
gccgtcgcgctcgtcatctggttcgtcggcccgttcgtcgcgttcggcgggctcacgccg
ctcgcgggcgcgggcatgcgcgtcctcgcgatcgcgctgctgctggcgggcgtgctgctg
tggctcgcgggccggccgacgagcatcgtgttcgtcgcgctgctgtgcgtgctgatctgg
catgcgtcgccgctgctcgcgttcggcggcgcgacgccgttcgcgccggaggcggtccgg
gcgatcgcgatcgcgctcgtgctcgcggcgttcgcgctgcaccttgcgttccggctgctg
caaaaggcgcgcaccgatccggattttctgaagagcctgctcgaattcggcggcaagcag
cccgaatcgcccgcggccggccgcctggtggcggtcaacgccgcgatcgccggcgcgatc
gcgcgcctgaaaggcatgcgcagcggcgcgcgcggcctgcgccgcctgttgcgcggcaag
cgctatctgtacgaactgccgtggtacgtcacgctcggctcgcgggcatgcggcaagacg
agcgcgctcctgaacgccgggctctcgtttccggtcgcggcgcaaatgccgcgcgcggca
gccgggctgccggatcacggcggctcggtcgactggtggttgaccaacgatgcggtgctg
atcgacacggccggccattacacgcgtcacggcacgtcggcgcacgcggcgccgctgccg
cccgccgggcccgcgccgcacgcccagcccttcgacgcggccgccgacgcgcgccgcgcg
aacggtcagccggccggcgagcggcacgccgtcgcgatggccgcggcggcgccgtcgagc
accgcgttcgtcgacgagcggcaggcgcaatggcggcagaccgtcgaccaggccgaatgg
ctgggctttctgcggacgctgcgcaagcatcggccgcgcgagccgatcaacggcgcgctg
ctcgccgtcgacgtcgccacgctcacgagcgccgacgacaatgcgcgccatgccgaggca
gccgcgctgcgcgcgcggctcgccgatctgcgcgcgcaactgggcgtgcgctttcccgtc
tatctgatcgtcacgaagacggaccagttgccgggcttcgccgaatacttcagcgcactg
accacggagggccgcgcgcagacgtgggggttcacgctgccgtacgacaaggagaccatc
gcggacgaaggcgtccacgcgcgctgcgccgacgagctgcgcgcgttggccgcgcggctc
gccgcgggcgtgaacacccgcctgcaggaagagcacgacacgcagcggcgccgccggctc
gccgcgctgccggaggaatttctcgtgctgacacgcccgctcggcgagctgatcgatcgc
gtcttcgccgattcccgctacgacgacacgcagcatcacgcgacgctgcgcggcgtgtat
ttcacgagcgccgcgcagacgggcggcgaggccgccgccgaaacgcgcaccgtcgcgcga
cgcctcgccgccgcgacgggccgcgcgccggccgcggccgcgcgcgcggcgcagcaggaa
accagccagagcttcttcctgcacgatctgctgacgaagatcgtcattccggacgcacgc
ctcgtccagccgaaccttcgctgggagtatcgctcgcgcacgctgagcctcgccgctcac
gcgctcgcgctgctgctgttcgcgtgggtcgcgatcggcctgcgcgtcagcatgggcaac
aacgatgcctatctcgacgcgctcgcgcgcaagacggcggcgctcgcctcccgggtcgac
cagttgtacaaggcgccgaagcccgaggccgtgcccgacgtgctgacgcaagcccgctcg
ctgagcgcgtacccgggcctcgatctgtccgcgccgggcagcggctggcggttcggcctg
tacacgccgcccggcatcgtcgccgaaagcagccgcacgtacgacgcgctcgaggacacc
ctgctgctgccgcggatcgtcacgcgcatcgaggcggtgctgtcgcaggcgatcgccgat
cgcgatccgaaggccgcgtacgacgcgctgcgcgtctatctgatgctgtacgaccgggcc
cgcttcgatgccgcgcaggtcgaggcgtgggtgctcgacgactgggcgcgaaccgacagc
gcggcggtcttcggcggccgcgcgtcgatgatcgcgcacgtcgagcaactgttccgcggc
gagcgcatcgtgcaatccccgctgatccgcaacgatgcgctgatccgccaggcgcgcgcg
ttcctggacggcagcaacgcgaccgagcggctctacgagcgcgcgaaggcggcgatggat
aaagaagcgcccgacgagttcacgctgctgcgggccgtcggcccgcaggccggcacggtg
ttcacgcgcgcgagcggcgcgccgctcgcgcggggcgtgccgggcctcttcacgttcgac
ggataccggcgcgtgttcgacaagcggctcgccgaattcgtgcggaccgcgcgcgaagac
gatgcatgggtgatgggccgcgcgtatctcggcgacgctcaaaaaaaaacggctgagatc
gcgaatgcgctcgcgggggccgacgatccgctgaccgacgcgatccgccggcaatatctg
atcgaatacgcgcagcaatgggacgcgtttctcggcgacatccgcacgatcggcggcacg
agcctcgcattcgatctcgtggtgctgcgcagcttcgcggcgccggattcgccgctcgag
cggctcgcgcgcgcggcggttcacgagacgacgctcgcgcagcccgaagcgagcgccgat
cgctcgttcctgcaaaaggcgtccgcccagttgagccagcaggcggacaaggcgctcggc
gtgcgcgcgcaggagcgcgtcgagcgcgagctcgtcgacaatcgcttcgcgggcttgcgc
gaaatggtgacgggccgcgcggacacgcaaacggacgcgcgcccgggcgcgccggccggc
aagagcgggctcgatgcggtcgcgaacctgctgaacgactactacacggcgctgaccgtc
tcggacgacgcgctcgcgaacaacagcatgccgcccgcgaacgataccgcggcgaaactg
aagatggccgcgcagacgatgcccgcgccgtttcgctcggtgctgaccgggctcgccgcg
cagggctcgcgcgaagtgaaccgcggcatcggccagttgctgtcgcggcagttgcaggcg
acggtaggcgacgtttgccgcctcgcgatcgagggcaactatccgttcgcgcccgacagc
aagcacgacgtcggcatcgaggacttcacgcgcgtgttcgcgcaaggcggcgtgatcgac
gacttcttcgcgaagacgctcgcgccgttcgtcgacacgtcgacgcggccttggcgctac
aagacgctgcccggcgcgaccgaaccggtggagggccccgatctcgaaccgtttcagcac
gcgaaggcgattcgcgaagtgtttttcggcgcgcccggccagaagcagatggcgtggaag
gccgacatccggattcccgaactggacccgacgatcacgagcctcgcgatcgacgtcgac
ggacagacggcgctctatcagcacggccccgtcgcgccgttcgcggtgagctggccgggg
ccgcgcggcggcgtgcacgcggagatcaccgcgagcccgcgcatccggccggacacgtcg
gcggtgtcgacggacggcccatgggcgctgctgcgcctgcttcagaagggacgcgtgagc
ggcacggcgacgcccgggcgcacgcgcgtcacgctcgacttcgacggccgcaaggcggtg
ctcgacctcgcgagcacgggcagcgtcgcgaatccgctgacgagcgacgtgctgaagacg
ttccggtgcccgggctcgatgccgatgttcagtctcgcggacaccggcgcgccgccgggc
ttgccgcccgggagcccggcggcgccgacgtcgcgcgtcgcgcgcgacgggcggtga

DBGET integrated database retrieval system