KEGG   Burkholderia pseudomallei MSHR305: BDL_6068
Entry
BDL_6068          CDS       T02756                                 

Definition
(GenBank) lysozyme family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpse02044]
    BDL_6068
Secretion system [BR:bpse02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BDL_6068
SSDB
Motif
Pfam: GPW_gp25 Sensor
Other DBs
NCBI-ProteinID: AGR68578
Position
1:3194301..3194828
AA seq 175 aa
MRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQRDLAFLLNT
TSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETL
VVAPSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
NT seq 528 nt   +upstreamnt  +downstreamnt
gtgcgcggcgaaggcctcgcgacgccgcgccgcgcgaacacgcaactgctgccgacgctg
atcgaccgcctgcgcgacgacgcgccgcaacggcagaccgaagcgcccggcgaatatgcg
ctcacgcgcatgcagatgcgcggcatcgtccagcgtgatctcgccttcctgctcaacacg
acgagcatcgacgagcacatcgatcgcgaacgccatccggccgccgccgcctcgacgctc
aacttcggcgtgccgccgcttgccggcgcgtttctcgcgtcgtgccagtgggccgaggtc
gaacgcatcatccgccgcgtgattctcgatttcgagccgcggctgatcgccgagacgctc
gtcgtcgcgccgtcgcgggccgccggcgcggtcgcgcgcccgaacgtgctcgcgttcgag
gtgcgcggcatgattcgtatggatccctatccgatcgaattcatggtgcaaagcgcgctc
gatctcgaaacgaaccaggtcaacatcaccggcatgcgcgcgagctga

DBGET integrated database retrieval system