KEGG   Burkholderia pseudomallei MSHR305: BDL_82Help
Entry
BDL_82            CDS       T02756                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00071  Fatty acid degradation
bpse00072  Synthesis and degradation of ketone bodies
bpse00280  Valine, leucine and isoleucine degradation
bpse00310  Lysine degradation
bpse00362  Benzoate degradation
bpse00380  Tryptophan metabolism
bpse00620  Pyruvate metabolism
bpse00630  Glyoxylate and dicarboxylate metabolism
bpse00640  Propanoate metabolism
bpse00650  Butanoate metabolism
bpse00900  Terpenoid backbone biosynthesis
bpse01100  Metabolic pathways
bpse01110  Biosynthesis of secondary metabolites
bpse01120  Microbial metabolism in diverse environments
bpse01130  Biosynthesis of antibiotics
bpse01200  Carbon metabolism
bpse01212  Fatty acid metabolism
bpse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BDL_82
   00630 Glyoxylate and dicarboxylate metabolism
    BDL_82
   00640 Propanoate metabolism
    BDL_82
   00650 Butanoate metabolism
    BDL_82
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BDL_82
   00072 Synthesis and degradation of ketone bodies
    BDL_82
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BDL_82
   00310 Lysine degradation
    BDL_82
   00380 Tryptophan metabolism
    BDL_82
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BDL_82
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BDL_82
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BDL_82
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpse04147]
    BDL_82
Enzymes [BR:bpse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BDL_82
Exosome [BR:bpse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BDL_82
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGR70439
Position
2:88112..89293
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGASVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAVVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGITAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFAKEG
TVTAANASGINDGAAAVLVMSAKKADALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMLKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgagcgtgattcgcgcggtgctcgaacgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctgggccaggtgctgacggcgggc
tcgggccagaatccggcgcgccaggcgctgatcgcggcggggctgccgaacgcggtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgcttgccgcgaac
gcggtcgtcgcgggcgatgcggagatcgtcgtcgcgggcggccaggagaacatgagcgcc
gcgcctcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagctcgtc
gacagcatgatcgtggatggcctctgggacgtctacaacaagtaccacatgggcatcacc
gcggagaacgtcgcgaaggagtacggcatcacgcgcgaggcgcaggaccagttcgccgcg
ctctcgcagaacaaggcggaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccgatcgagatcccgcagagaaagggcgagccgctgcgtttcgcgaccgacgagttcgtg
cgtcacggcgtgacggccgagtcgctcgcgggcctgaagcccgcgttcgcgaaggaaggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgacgcgctcggcctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcgtcgcgccgctgt
ctcgagcgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggttcacaagcagatgggctgggatacgtcgaaggtcaacgtg
aatggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgctcaagcgcgatgcgaaacgcggcctcgcatcgctttgcatc
ggcggcgggatgggcgtcgcgctcgcgctcgagcgtccgtaa

DBGET integrated database retrieval system