KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_1293Help
Entry
DR55_1293         CDS       T03422                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR55_1293 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpsh03011]
    DR55_1293 (rplV)
Ribosome [BR:bpsh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR55_1293 (rplV)
  Bacteria
    DR55_1293 (rplV)
  Archaea
    DR55_1293 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AIP51096
Position
1:1506779..1507108
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgacatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgtttcaccgcgcgcgcaaagggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system