KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_2392Help
Entry
DR55_2392         CDS       T03422                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00620  Pyruvate metabolism
bpsh00630  Glyoxylate and dicarboxylate metabolism
bpsh01100  Metabolic pathways
bpsh01110  Biosynthesis of secondary metabolites
bpsh01120  Microbial metabolism in diverse environments
bpsh01200  Carbon metabolism
Module
bpsh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR55_2392 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    DR55_2392 (aceB)
Enzymes [BR:bpsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DR55_2392 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AIP52603
Position
1:complement(2716715..2718307)
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIKPGYEAILTPEALELVAKLHRQFEPRRRELLAARVERTQRLDA
GERPDFLAETKSIREGDWKIAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALFLFHNAQELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEALGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDRAMAGVRADKARDAGDG
YDGGWVAHPGLVSLAMEEFVKVLGDKPNQIGKQRDDVQIEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTAELV
REYAKVELANVKQVVGGDTAPYDRAAAIFEQMSTSENFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgaagctgccgcaaggcatggcgatcacgggcgaaatcaagcccggc
tacgaagcgatcctcacgcccgaggcgctcgaactcgtcgcgaagctgcatcgccagttc
gagccgcgccgccgcgagctgctcgccgcacgcgtcgagcgcacccagcgcctcgacgcc
ggcgagcgccccgacttcctcgccgaaacgaaatcgatccgcgagggcgactggaagatc
gcgccgctgcccgcggacctgcaatgccgccgcgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgaacagaacggcaagtcgtacaagctcaacgacaagatcgcg
acgctgatcgtgcgcccgcgcggctggcacctcgacgaaaagcacgtgacggtggacggt
cagcgcgtgtcgggcggcgtcttcgatttcgccctcttcctgttccacaacgcgcaggag
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggaaagccatctggag
gcgcgcctctggaacgacattttcgtcgccgcgcaggaagcgcttggcgtgccgcgcggc
acgatccgcgcgaccgtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgcgggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctcgccgatcgcgcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgcccgcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggaa
gcgaacgatcgcgccatggcgggcgtgcgcgcggacaaggcgcgcgacgccggcgacggc
tatgacggcggctgggtcgcgcacccgggcctcgtgtcgctcgcgatggaggagttcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgag
ggcaagaacctgctcgatttccagccggaagcgccgatcaccgaagccgggctgcgcaac
aacatcaacgtcggcatccactacctcggctcgtggctcgcgggcaacggctgcgtgccg
atccacaacctgatggaagacgcggcgacggccgagatctcgcgctcgcaggtctggcaa
tggatccgttcgccgaagggcacgctcgacgacggccgcaaggtcacggccgagctcgtg
cgtgagtacgcgaaggtcgagctcgcgaacgtgaagcaggttgtcggcggagataccgcg
ccgtacgatcgcgccgcggcgatcttcgagcagatgtcgacgtcggagaacttcaccgag
ttcctgacgctgccgctctacgaagagatctga

DBGET integrated database retrieval system