KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_5777Help
Entry
DR55_5777         CDS       T03422                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00430  Taurine and hypotaurine metabolism
bpsh00620  Pyruvate metabolism
bpsh00640  Propanoate metabolism
bpsh00680  Methane metabolism
bpsh01100  Metabolic pathways
bpsh01120  Microbial metabolism in diverse environments
bpsh01200  Carbon metabolism
Module
bpsh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR55_5777 (ackA)
   00640 Propanoate metabolism
    DR55_5777 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    DR55_5777 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DR55_5777 (ackA)
Enzymes [BR:bpsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DR55_5777 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase HrpB1_HrpK
Motif
Other DBs
NCBI-ProteinID: AIP55175
Position
2:complement(3022708..3023886)
Genome map
AA seq 392 aa AA seqDB search
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAA
PVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPL
APLHQPQSVRLIRALRHLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFH
GLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATR
CGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALEL
FAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAE
TVSRDGSRVAVLVVPTDEEQVIARDAASVLHA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgctgctgctcacgttcaacgccggctcgtcgacgctgaagatcggcctc
tacagcgtcgcgaacggcgaacccgcgccgctcgggcgcggcaagatcgatttcaaccgc
gcgccgctgcagttcgaatacgcgaacggcggcgaagcgcacgcggtgccgctcgccgcg
cccgtcaccgacgatctgcacgcggtgctcgacgaggcgctcggctggatcgacgcgcac
ctgtcggtgcacgagctcgtgtcggtcggccatcgcgtcgtgcacggcggcgacacgttc
gacgggccggtgcgcatcgacgagcgcacgctcgacgcgatcgcggcgctcgtgccgctc
gcgccgctgcatcagccgcagagcgtgcggctgatccgcgcgctgcgccatttgcggccg
catctgccgcaggtcgcatcgttcgataccgcgtttcaccgcacgcagtccgatctcgtg
cggcgcttcgcgctgccgcgcgcgctgttcgacgcaggcatcaagcgctacggttttcat
gggctgtcgtaccggtacgtcgccgggcggctgcgcgagcggcatccgtcgattgcgcgc
ggcaaggtcgtcgccgcgcatctcggcagcggcgcgagcctgtgcgcgctcgacgcgggc
gtgagccgcgacaccagcatgggcttctcgacgctcgacggcattccgatggccacgcgc
tgcggcgcgctcgacgcgggcgtcgtgctgcatctgcagaagacgctcggccggacgctc
gacgacgtcgagcagatgctgtaccaccgctcgggcctgctcggcgtgtcgggcgtgagc
ggcgacgcgcgcgcgctgctcgccgatccttcggccggcgcgcgcgacgcgctcgaactg
ttcgcgttccggatcgcgggcgagaccgcgcggctcgcggcgacgctcggcggcctcgac
gcgctcgtgttcacggcgggcatcggcgagcatcagccgcagacgcgcgcggcggtatgc
gagcggctgcgctggctcggcgtcgagctcgatgcgcacgcgaacgcgcgcaatgcggag
accgtcagccgcgacgggagccgcgtcgcggtgctcgtcgtgccgaccgacgaggagcag
gtgatcgcgcgggatgcggcgtcggtgctgcatgcctga

DBGET integrated database retrieval system