KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_714Help
Entry
DR55_714          CDS       T03422                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00071  Fatty acid degradation
bpsh00072  Synthesis and degradation of ketone bodies
bpsh00280  Valine, leucine and isoleucine degradation
bpsh00310  Lysine degradation
bpsh00362  Benzoate degradation
bpsh00380  Tryptophan metabolism
bpsh00620  Pyruvate metabolism
bpsh00630  Glyoxylate and dicarboxylate metabolism
bpsh00640  Propanoate metabolism
bpsh00650  Butanoate metabolism
bpsh00900  Terpenoid backbone biosynthesis
bpsh01100  Metabolic pathways
bpsh01110  Biosynthesis of secondary metabolites
bpsh01120  Microbial metabolism in diverse environments
bpsh01130  Biosynthesis of antibiotics
bpsh01200  Carbon metabolism
bpsh01212  Fatty acid metabolism
bpsh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR55_714
   00630 Glyoxylate and dicarboxylate metabolism
    DR55_714
   00640 Propanoate metabolism
    DR55_714
   00650 Butanoate metabolism
    DR55_714
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DR55_714
   00072 Synthesis and degradation of ketone bodies
    DR55_714
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR55_714
   00310 Lysine degradation
    DR55_714
   00380 Tryptophan metabolism
    DR55_714
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR55_714
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR55_714
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DR55_714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsh04147]
    DR55_714
Enzymes [BR:bpsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR55_714
Exosome [BR:bpsh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR55_714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIP52768
Position
1:852490..853683
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcgccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcacggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgatctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaggcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system