KEGG   Basilea psittacipulmonis: IX83_07665Help
Entry
IX83_07665        CDS       T03226                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bpsi  Basilea psittacipulmonis
Pathway
bpsi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IX83_07665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpsi02022]
    IX83_07665
Two-component system [BR:bpsi02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   IX83_07665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIL33186
UniProt: A0A077DG83
Position
1730674..1731405
Genome map
AA seq 243 aa AA seqDB search
MTNRKILIVDDDERLRELLQQYLQGQGYYVDIAKDAVSMDQLFPTQPYDLIVLDIMLPDE
DGLSICRRLRGKNITTPILMLTAKTEEIDRILGLEMGADDYLTKPFNPRELLARINAILR
RVPKENSSATTAHALSSHSEEIYTFGQFTLNLTTRTLSKQGKIIPITTSELGLLKVFIQN
ANTPLSRDQLMEQTKGKEYEVFNRSLDVQISRLRKLIEPNPTDPIHIKTVWGVGYVFITE
PNT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtaaaatattaatcgtggacgacgacgaacgtctgcgcgagttacttcaa
caatacctccaaggtcaagggtattatgttgatattgctaaagatgctgtatcaatggac
cagctgttccctacccagccttatgatttaattgttttggacattatgctacccgatgag
gacggcttatcaatctgtcgtcgtctaagaggtaaaaatattaccacacctattttgatg
ttgacggccaaaacagaagaaatcgatcgtattttgggcttagaaatgggggccgacgat
tatctaacaaaaccttttaatcctcgagaattactggcacgcattaacgccattttaaga
cgtgttccgaaagaaaattcatccgcgacaacggctcacgctttgtcatcacactcagaa
gaaatctatacattcggacaatttaccttaaatttaaccactcgtactttgagcaaacaa
ggcaaaatcattcctatcacaaccagtgaactagggcttttaaaagtatttatccaaaat
gccaacacgcctttatcacgtgaccagctcatggaacaaaccaaagggaaagagtacgaa
gtgtttaatagaagcttggatgtccaaatctcacgtttaagaaaactcattgaacccaac
cccactgatcccatccatatcaaaactgtttggggcgtaggatacgtgtttattaccgaa
cccaatacctaa

DBGET integrated database retrieval system