KEGG   Burkholderia pseudomultivorans: WS57_03660Help
Entry
WS57_03660        CDS       T04870                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00071  Fatty acid degradation
bpsl00072  Synthesis and degradation of ketone bodies
bpsl00280  Valine, leucine and isoleucine degradation
bpsl00310  Lysine degradation
bpsl00362  Benzoate degradation
bpsl00380  Tryptophan metabolism
bpsl00620  Pyruvate metabolism
bpsl00630  Glyoxylate and dicarboxylate metabolism
bpsl00640  Propanoate metabolism
bpsl00650  Butanoate metabolism
bpsl00900  Terpenoid backbone biosynthesis
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
bpsl01120  Microbial metabolism in diverse environments
bpsl01130  Biosynthesis of antibiotics
bpsl01200  Carbon metabolism
bpsl01212  Fatty acid metabolism
bpsl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS57_03660
   00630 Glyoxylate and dicarboxylate metabolism
    WS57_03660
   00640 Propanoate metabolism
    WS57_03660
   00650 Butanoate metabolism
    WS57_03660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS57_03660
   00072 Synthesis and degradation of ketone bodies
    WS57_03660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS57_03660
   00310 Lysine degradation
    WS57_03660
   00380 Tryptophan metabolism
    WS57_03660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS57_03660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS57_03660
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS57_03660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsl04147]
    WS57_03660
Enzymes [BR:bpsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WS57_03660
Exosome [BR:bpsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS57_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt UPF0731
Motif
Other DBs
NCBI-ProteinID: AOI87947
Position
2:complement(877691..878875)
Genome map
AA seq 394 aa AA seqDB search
MIDAVIVSTARTPIGKAYRGAFNLTHSPTLLGHAIRHAVLRAGIEPDRIEDAVIGSVLNA
GTAGGNIARHGVLAAGLPASVAAQTLDRQCASGLMAIATAAKQIMCDGMQVVVAGGQENI
SAVQTRYFEWTRADEDPNVLAAQPAAYMPMLETAEFVSRKYGISRDVQDQYALDSQLRTA
AAQAAGRFSSEIVPITTQKLVVDKTTGTTSRHEVTLTQDEGNRPGTTLESLATLAPVIDG
GVVTAGNASQLSDGASACVLMNGKTAEQIGATPLGIYRGMTVVGNAPEEMGIGPIYAIPK
LLELHGLKTDDIGLWELNEAFACQALYCREKLGIDPARYNVNGGSISIGHPYGMTGARMV
GHALIEGKRRGARYVVVSMCVGGGMGAAGLFEVA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgccgtcatcgtttccaccgcacgtacgcccatcggaaaggcatatcgcggt
gcattcaacctcacgcactcgcctaccctgctcgggcacgcaatccggcacgcggtcctg
cgtgccggcatcgagccggatcgcatcgaggacgccgtgatcggttcggtactcaacgcc
gggaccgccggcggcaatatcgcccgacacggcgtgctggcagccggattgcctgccagc
gtcgctgcgcaaacactcgaccggcaatgtgcgtctggcctgatggcgatcgcgacggct
gccaagcagattatgtgcgacgggatgcaggttgttgtggcgggtggccaggaaaacatc
tctgcggtacaaacgcgctacttcgagtggacccgcgccgacgaggaccccaatgtgctg
gccgcgcaacccgcggcctacatgccaatgctcgagaccgccgagttcgtttcccgcaag
tacgggatctctcgggacgtccaggatcagtacgcactcgattcccagctccgcactgcc
gccgcacaggccgccggccgcttctcgagcgaaatcgttccgatcacgacacagaagctg
gtcgtcgacaaaacgaccggcacgacgtcgaggcatgaggtcacgctcacgcaggacgag
ggaaatcgtcccggcacgacgctcgaatcgctggccacgctcgcaccggtaatcgacggc
ggcgttgtgacggcgggtaacgcgagccagctttcggacggtgcaagcgcctgcgtcctg
atgaacggaaaaaccgccgagcagatcggggccacccctctcggtatctatcgaggcatg
accgtcgtcggcaatgcgccggaggagatgggcatcggtcccatctacgcgatccccaag
cttctggagcttcatggcctcaaaactgacgatatcggcttatgggagctcaatgaggcg
tttgcctgccaggcgctgtactgccgtgagaagctgggaattgatcccgcgcgatacaac
gtcaacggcggcagcatttctatcggccatccgtacgggatgaccggcgcgcgcatggtc
ggccatgccctgatcgaaggcaaaagacgcggtgcacgctacgtcgttgtttcgatgtgt
gtaggcggcggaatgggtgcggccggcttgttcgaagtcgcttga

DBGET integrated database retrieval system