KEGG   Burkholderia pseudomultivorans: WS57_03680Help
Entry
WS57_03680        CDS       T04870                                 

Definition
(GenBank) cytochrome
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00071  Fatty acid degradation
bpsl00380  Tryptophan metabolism
bpsl00627  Aminobenzoate degradation
bpsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS57_03680
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    WS57_03680
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    WS57_03680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bpsl00199]
    WS57_03680
Enzymes [BR:bpsl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     WS57_03680
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     WS57_03680
Cytochrome P450 [BR:bpsl00199]
 Cytochrome P450, bacteria type
  CYP102 family
   WS57_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 PT-TG
Motif
Other DBs
NCBI-ProteinID: AOI87951
Position
2:complement(883312..886500)
Genome map
AA seq 1062 aa AA seqDB search
MKSSALVPQPPLKPIIGHLMEVLGPSPLAKMMDLARTYGPVYWFEVFGQGYYVVSGQALV
DEVCDESRFQKSVHQSLLELRPAIGDGLFTAFSDEPNWAKAHRVLMQSFGPLSIWSMFDK
MVDIADQMFLYWERFGPETAVDVSDHMTRLTLDTIALCAFDCRFNSFYREDQHPFVDAMV
NTLSEAGKRELRPKLVSKLMLNRSRKFDADIELMRSLATKMIEDRRKNPHDNEEAMDLLD
RMLNGVDPVTGEKLDDENIVFQMITFLIAGHETTSGLLSFATYFLLKNPDVLQRARDMVD
EVVGNDTPRIEHLARLRYIEQILMETLRIWPTAPAFAVTPLADTTFGGKYPVSPNDIIMI
LTPMLHRDVSVWGEDVEAFRPERFEPENAEKLPPNSWKPFGNGARACIGRPFAMQEAHLV
LIMLLQRFDFSFADPNYELQVAETLTLKPTGLRINVRPRARGVRKVSNDNLRVRASIETP
NVDQAPAVSDKDASKMLVLFGGNTGSSESFARRIAGDAGRHGFHATCAPLDAFAGKIDGF
PAIVVVTASYEGQPPDNAIAFLPYIEAMSEGALDGVKFSVLGCGNKQWARTYQAIPKRVD
AAFEKAGATRVHARGELDSGGDFFGEFDRWYAGFWNRFAISFGKDTSVAQSSNSALNVSF
LNNVREKLLSVDDMTHATVIDNRELVDISVPGSRSKKHMELKLPETMTYRSGDYLAVLPR
NSKRNVDRVLRRFRLSWDTQVVIDGTSSNPRLPLGQAISCGELLSSYVELAVPATRSQVS
ILAAATRCPPEKVELERLSTGDFEYEILEKRTTVMDLLERFGSVDLSFDKFLDMLPALKA
RQYSISSSPLWKADHVTLTVAVVDAPALSGNGRHEGVASSYLARLDAGDSVSVSVRPSNA
RFRPPVESNLPMILICAGSGIAPFRGFLQERAIQKQRGENVGPSLLFFGIDDPDVDFLYR
DELEEWANLGVVEVMPAYSNRPEEGARFVQDKVWLEREKIAALFAQGATVYVCGDGKNMA
PAVRATLGRIYQDSTGANDESAHAWIDTMEREHGRYVADVFA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctccgccctcgttccgcagccgcctctgaagcccatcatcggccatctgatg
gaggtcctcgggccatcgccgctcgcaaagatgatggatctcgcacgaacctacgggccg
gtctactggttcgaggtattcgggcaaggttactacgttgtcagcggacaagcactcgtc
gatgaggtgtgcgacgaaagcaggtttcagaaatctgtacaccaatctctgcttgaactg
agaccggccatcggggatggcctattcacggcattcagcgacgaaccgaactgggcaaaa
gcgcatcgtgtattgatgcagtcgtttggcccactcagcatttggtccatgttcgacaag
atggtcgacatcgccgaccagatgtttctctattgggaacgattcggcccggagacggct
gtcgatgtctccgaccacatgactcgcctgacgctcgacacgatcgccttatgtgcgttc
gactgtcgcttcaatagcttctaccgtgaagatcagcatccgttcgtggatgcgatggtc
aataccctcagcgaggcgggaaagcgcgagttgcggccgaaactggtgtcgaagctgatg
ctcaaccggagtcgcaagttcgacgcggacatcgagctcatgcgatcgctcgcgaccaaa
atgatcgaagacaggcggaagaacccgcacgacaacgaagaagcgatggacctgctggac
cgaatgctgaacggtgtcgatccggtgacgggcgagaagctcgatgacgagaatatcgtc
ttccagatgattacgttcctcatcgccgggcatgaaacgacgagcgggctcttgtccttt
gccacctatttcctcctcaagaacccggacgttctgcaacgagcacgggacatggtcgac
gaggtcgtcggcaacgacacgccacggatcgagcatctggcgcgactgcgctacatcgaa
caaatcctgatggaaacgttgcggatctggccgacggctccggctttcgccgtcacccca
ctcgccgacaccacgttcggcgggaagtatcccgtgtctcccaacgacatcatcatgatc
ctgacgcccatgttgcatcgcgacgtaagcgtctggggcgaggacgtcgaggcgtttcgt
cccgagcgattcgaaccggagaatgcggaaaaacttccgccgaattcgtggaaacccttc
ggcaatggcgcacgcgcatgtatcggccgaccgttcgcaatgcaggaagcgcacctcgtc
ctgatcatgctgcttcagcgattcgatttttccttcgccgatccgaactacgagctgcaa
gtcgccgaaacccttacgctcaagcccaccggcctgcgtatcaacgtgcggccacgggcg
cgaggtgtgcgcaaggtatcgaacgacaaccttcgcgtgcgtgcgagcatcgaaacgccg
aacgtcgatcaggctccggcggtctccgacaaggacgcgtcgaagatgctggtcctgttt
ggcgggaacacgggttcgtcggaatctttcgctcgccgcattgcaggcgacgccggtcgc
cacggatttcatgccacctgtgctcctctggacgcgttcgcaggaaagatcgacggattt
cctgcgatcgtagtcgtcactgcttcctacgaaggccagccgcccgacaatgcaatcgca
tttcttccctatatcgaggcgatgagcgaaggggcactggacggagtcaaattttctgtt
cttggatgcggcaacaagcagtgggcaagaacgtatcaggcgatccccaagcgcgtcgac
gcagccttcgaaaaagccggcgccacgcgcgttcacgccagaggcgagctggattccggt
ggtgacttctttggcgagtttgatcgatggtatgccgggttctggaatcgctttgcaatc
agcttcgggaaggacacgtcggttgcgcaaagtagcaattccgcactcaacgtcagcttc
ctgaataacgttcgcgagaaattgctcagcgttgacgatatgacgcacgcgacggtgatc
gacaatagagagctcgtcgatattagtgtgccgggaagccggtcgaagaagcacatggaa
ctgaagttaccggagacgatgacctatcgctccggcgactacctggccgttctgcctcgc
aattccaaacggaacgtcgatcgcgtcttgcgccggtttcgcctgagctgggacacgcaa
gtggtcatcgacgggacatcgagcaatccgcgccttccgctcggccaggcaatcagttgc
ggcgagctgctttcgagctacgttgaacttgccgttccggccactcgatcgcaagtctcc
atccttgccgcggccactcgctgtccgcccgagaaggtcgagctcgagcgcctgagcacc
ggcgacttcgaatacgagattctggaaaaacgaaccaccgtcatggatctgctcgaacgc
ttcggctccgtcgatttgtcgttcgacaagttcctcgacatgctccccgcgttgaaagca
cgccagtactcgatctcgtcgtctccactctggaaagcagatcacgtgacactgacggtc
gccgtagtcgatgcaccggcactctccggcaacggccgtcacgaaggggtggcgtcgtcg
tatctcgcgcggctcgacgcgggtgacagtgtgtccgtttcggtcaggccgtcgaatgca
cgctttcgtccgccagtcgaatcgaaccttccgatgatcttgatttgcgcgggttccggt
attgccccgttccgcggctttctgcaagagcgtgcaatacagaaacagcggggagaaaac
gtcggcccgtcgttgcttttcttcggaatcgatgaccccgacgtcgactttctctatcgc
gatgagctcgaagagtgggcgaacttgggggtggtcgaagtgatgcccgcctattccaac
cgcccggaggaaggcgctcgcttcgtccaggacaaagtatggctcgagcgggaaaaaatc
gccgcgctgtttgcgcaaggcgccaccgtttatgtatgcggggatggcaagaacatggcg
cccgccgtacgtgccacgctcggtcggatttaccaggactcaaccggcgcgaatgatgaa
agcgctcacgcgtggatcgacacgatggagcgcgagcatggcaggtatgttgccgatgtg
ttcgcatga

DBGET integrated database retrieval system