KEGG   Burkholderia pseudomultivorans: WS57_06785Help
Entry
WS57_06785        CDS       T04870                                 

Definition
(GenBank) phospholipase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00562  Inositol phosphate metabolism
bpsl00564  Glycerophospholipid metabolism
bpsl00565  Ether lipid metabolism
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
bpsl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    WS57_06785
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WS57_06785
   00565 Ether lipid metabolism
    WS57_06785
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    WS57_06785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpsl02042]
    WS57_06785
Enzymes [BR:bpsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     WS57_06785
Bacterial toxins [BR:bpsl02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   WS57_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AOI88520
Position
2:1608924..1610597
Genome map
AA seq 557 aa AA seqDB search
MFRQALLVTACAGAALALFACGGSDDPTPTPAVSSQDALQTATPIKHVVVIYGENVSFDH
YFGTYPNATNPAGEPAFTAKSGTPTVNGLTGTLLTANPNFTNTANGTDAANPFRLDRTQA
ATADQNHAYTAEQQAEDNGLADLFPKYTGKGSSGGAGAFGTKGQVMGYFDGNTVTALWNY
AQRFAMSDNAYTTVYGPSTPGALNVVSGQTNGMQIVKTSAQPSTLAKSSYYINDGQGGYT
MINDVDPGYDVCSSTTDQAMMSGKNIGDLLNSAKITWGGFMGGFNLSTTNSNGTTGCSRS
TVATAVNAATADYIPHHNWFQYYASTANPQHTRPSSTAAIGSSFETDGKTAEPANHQYDT
DDFFAAVKAGNFPSVSFLKAPAAQDGHAGYSDPLDEQAFVTKVVNFLQQQPDWQNTAVIV
TYDDSDGWYDHAYTTPTRASSDAVDQVNGNGKCGSGGTTGVNGATVNGRCGPGVRIPLVV
ISPYAKQNYVDHTQIDQASVVRFIEDNWLGGQRIGGGSFDATAGDLRGLFDFSSKPNTTP
LYLDPTQGTVLSAAPSM
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcaagccttgctcgtcaccgcctgtgccggcgcagccctcgcgctgttcgcc
tgcggcggcagcgacgatcccacgccgacgcccgcggtgtcctcgcaggacgcgctgcag
accgccacgccgatcaagcacgtcgtcgtgatctacggcgagaacgtgtcgttcgaccac
tacttcggcacctatccgaatgcgacgaacccggcgggcgagccggcgttcaccgccaaa
tccggcacgccgacggtcaacggcctgacgggcacgctgctcaccgcgaacccgaacttc
acgaacacggccaacggcaccgacgccgcgaacccgttccgcctcgaccgcacgcaggcc
gcgacggccgaccagaaccacgcgtacacggccgaacagcaggccgaggacaacggcctc
gccgacctgttcccgaaatacaccggcaagggctcgtccggcggcgccggcgcgttcggc
acgaagggccaggtgatgggctacttcgacggcaacaccgtgaccgcgctgtggaactac
gcgcagcgcttcgcgatgagcgacaacgcctatacgacggtctacggcccgtcgacgccg
ggcgcgctgaacgtcgtgtcgggccagaccaacgggatgcagatcgtcaagacgtccgcg
cagccgtcgacgctcgcgaagagctcgtactacatcaacgacggccagggcggctacacg
atgatcaacgacgtcgaccccggctacgacgtctgttcgagcacgaccgaccaggcgatg
atgagcggcaagaacatcggcgacctgctgaacagcgcgaagatcacgtggggcggcttc
atgggcggcttcaacctgtcgacgacgaacagcaacggcacgacgggctgcagccgcagc
acggtcgcgaccgccgtgaacgccgcgacggccgactacatcccgcaccacaactggttc
cagtactacgcgtcgaccgcgaacccgcagcacacgcgcccgagctcgaccgccgcgatc
ggctcgagcttcgagaccgacggcaagaccgccgagcccgcgaatcaccagtacgacacc
gacgacttcttcgcggccgtgaaggccggcaacttcccgtcggtcagcttcctgaaggcg
ccggccgcacaggacggacacgcgggctattcggatccgctcgacgagcaggcgttcgtg
acgaaggtcgtcaacttcctgcagcagcagccggactggcagaacacggccgtgatcgtc
acctatgacgactcggacggctggtacgaccacgcgtacacgacgccgacccgcgcgtcg
tccgacgcggtcgaccaggtgaacggcaacggcaagtgcggttcgggcggcaccaccggc
gtgaacggcgcaacggtgaacggccgctgcggccccggcgtgcgcattccgctcgtcgtg
atctcgccgtacgcaaagcagaactacgtcgaccatacgcagatcgaccaggcgtccgtc
gtgcgcttcatcgaggacaactggctcggcggccagcgcatcggcggcggttcgttcgat
gcgaccgcaggcgacctgcgcggcctgttcgacttctcgtcgaagccgaacaccacgccg
ctgtatctcgatccgacgcaaggcaccgtgttgagcgcggcgccgtcgatgtaa

DBGET integrated database retrieval system