KEGG   Burkholderia pseudomultivorans: WS57_08375Help
Entry
WS57_08375        CDS       T04870                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00280  Valine, leucine and isoleucine degradation
bpsl00410  beta-Alanine metabolism
bpsl00562  Inositol phosphate metabolism
bpsl00640  Propanoate metabolism
bpsl01100  Metabolic pathways
bpsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WS57_08375
   00562 Inositol phosphate metabolism
    WS57_08375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS57_08375
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WS57_08375
Enzymes [BR:bpsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     WS57_08375
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     WS57_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF4260
Motif
Other DBs
NCBI-ProteinID: AOI88815
Position
2:1983414..1984940
Genome map
AA seq 508 aa AA seqDB search
MNAAVPQTTLALPTAKLLIDGAFVESQSAEWGDIVNPATQETIGRVPYATVEEVDAAIAS
AQRAFQTWKTTPVGARLRIMLKFQDLVRRNLERIATTLTAEQGKTLPDAQGDIFRGLEVV
EHACSIGTLQLGEFAENVAGGVDTYTLRQPIGVCAGITPFNFPGMIPLWMFPMAIVCGNT
FVLKPSEQDPLSTMQLVELAIEAGVPKGVLNVVHGGKTVVDRLCTHPDVKAISFVGSTRV
GTHVYNLGSEHGKRVQSMMGAKNHAVVLPDAHREQTINALVGAGFGAAGQRCMATSVVVL
VGAARDWLPDLVEKAKALKVNAGHEPGTDVGPVVSKAAHARIVGLIDEGVKAGAKLLLDG
RDVKVPGYEHGNFVGPTIFSGVTTDMSIYTEEIFGPVVVVLEADTLDDAIALVNRNPMGN
GVGLFTQSGAAARKFQSEIDVGQVGINIPIPVPVPYFSFTGSRGSKLGDLGPYGKQVVQF
YTQTKTVTARWFDDDATAGGVNTTIALR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgcagttccccagaccaccctcgccctgcccaccgccaagctgctgatcgac
ggcgccttcgtcgaatcgcaaagcgccgaatggggcgacatcgtgaatcccgccacgcag
gaaacgatcggccgcgtgccgtatgcgacggtcgaagaggtcgacgccgcgatcgcctcc
gcgcagcgcgcgttccagacctggaagaccacgccggtcggcgcgcggctgcgcatcatg
ctgaagttccaggacctggtgcgccgcaatctcgaacggatcgcgacgacgctgacggcc
gaacagggcaagacgctgcccgacgcgcagggcgacatcttccgcggcctcgaagtggtc
gagcacgcgtgctcgatcggcacgctgcagctcggcgagttcgcggagaacgtcgcgggc
ggcgtcgatacctacacgctgcgccagccgatcggcgtgtgcgccggcatcacgccgttc
aactttcccggcatgatcccgctgtggatgttcccgatggcgatcgtctgcggcaacacg
ttcgtgctgaagccgtcggaacaggatccgctgtcgacgatgcagctcgtcgaactcgcg
atcgaggccggcgtgccgaagggcgtgctgaacgtcgtgcacggcggcaagaccgtggtc
gatcgtctctgcacgcatccggacgtcaaggcgatctcgttcgtcggctcgacgcgcgtc
ggcacgcacgtgtacaacctcggcagcgagcacggcaagcgcgtgcagtcgatgatgggc
gcgaagaatcacgcggtcgtgctgcccgacgcgcatcgcgagcagacgatcaacgcgctg
gtcggcgcgggcttcggcgcggccggccagcgctgcatggcgacctcggtcgtcgtgctg
gtcggcgccgcgcgggactggctgcccgatctggtcgagaaggcgaaggcgttgaaggtc
aacgcggggcacgagcccggcaccgatgtcgggccggtcgtgtcgaaggccgcgcatgcg
cgcatcgtcgggctgatcgacgaaggcgtgaaggccggcgcgaagctcctgctcgacggc
cgcgacgtgaaggtgcccggctacgagcacggcaatttcgtcggcccgacgatcttctcg
ggcgtgacgaccgacatgtcgatctatacggaagaaatcttcgggccggtggtggtcgtg
ctggaggccgacacgctcgacgacgcgatcgcgctcgtcaaccgcaacccgatgggcaac
ggcgtcggcctgttcacgcagagcggcgcggccgcgcgcaagttccagagcgaaatcgac
gtcggccaggtcggcatcaacatcccgattccggtgccggtgccctacttcagcttcacc
ggttcgcgcggctcgaagctcggcgatctcggcccgtacggcaagcaggtcgtgcagttc
tacacgcagacgaagacggtcaccgcgcgctggttcgacgacgacgcgacggccggcggc
gtgaacacgacgatcgcgctgcgctga

DBGET integrated database retrieval system