KEGG   Burkholderia pseudomultivorans: WS57_12740Help
Entry
WS57_12740        CDS       T04870                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WS57_12740
Enzymes [BR:bpsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WS57_12740
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WS57_12740
    1.1.1.-  
     WS57_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOI89580
Position
2:2942245..2943366
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGARDVRLVEIDTPRVGPDEVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
GRTAPLTLGHEFCGTVVETGANVTALRAGDRVAIEPEYRCRRCAYCRAGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGDTCAVFGL
GPIGLLLIMLAKLQGATTIAAVDVSPERLAAATRFGATHVFDARAFDPPALRDAIHAATG
GLGVDASFEAAGLPSTFEAAMHALRKGGRVVMVGLMPHASFDAFRAVNDELTFTASVGYR
HAYEDLLRLVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPALGPARRTH
VTGSIEHEPAVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcgcgcgcgacgtgcgcctcgtcgagatcgacacgccg
cgcgtcgggcccgacgaggtccgcatcgcggtcgcgtattgcggaatctgcggcagcgat
ctgcatgagtacgcggacggcccgcatgcgatcccggtcgatgcgccgcatccgctgtcg
ggccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtggtcgaaaccggc
gcgaacgtcaccgcgctgcgcgccggcgaccgcgtcgcgatcgagcccgagtatcgctgc
cgtcgatgcgcgtactgccgcgccgggtcgtacaacctgtgcgtgtcgatgggcttcgcc
ggactgatgggcgacggcgggatggccgacttcgcggtcgtgcccgcctacatgctgcat
cggctgcccgacggcgtcagcctcgaacaagccgcggtgatggaaccggccgccgtcgcg
ctgcatgcgctgcggcgcggcgaactgcggctcggcgacacctgcgcggtgttcgggctc
gggccgatcggcctgttgctgatcatgctcgcgaagctgcagggcgcgacgacgatcgcc
gccgtcgacgtgtcgcccgaacgtcttgcggcagccacgcgcttcggcgcgacgcacgtg
ttcgacgcccgcgcgttcgacccgcccgcgctgcgcgacgcgattcacgcggccaccggc
gggctcggcgtcgacgccagtttcgaggcggccggactgccgtccacgttcgaagcggca
atgcacgcactgcgcaagggcggccgcgtcgtgatggtcggcttgatgccgcatgccagc
ttcgatgcattccgcgcggtcaacgacgaactgacgttcacggcaagcgtcggctaccgg
catgcatacgaggatctgctgcgcctcgtcgcgtcgggcgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaggacgcggtcgcggacggcttcgacgcgctgctcgcg
gatcgcgcgcagatcaagatcctggtttcccccgcgctcgggcccgcccggcgcacacac
gtcacagggagcatcgagcatgagccagccgtcggtgtttga

DBGET integrated database retrieval system