KEGG   Burkholderia pseudomultivorans: WS57_15655Help
Entry
WS57_15655        CDS       T04870                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00564  Glycerophospholipid metabolism
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
Module
bpsl_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    WS57_15655
Enzymes [BR:bpsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     WS57_15655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC
Motif
Other DBs
NCBI-ProteinID: AOI90316
Position
1:complement(639553..640803)
Genome map
AA seq 416 aa AA seqDB search
MSNGNKSPAATRRRLGAWLAGEEAHMAAYRRRIAADAQAHAGDRLRTPAVQELARLFDDN
AVLQMGLSRAIDEARDAGHDLGYGSIGELMTVIDHLMTYTPPFSEASLIVCPLNAFLDRP
MCMPSGYPVFRDAAVNAHLKRVLTVWCDFLGGPHSRVHLDTTPPDGWFCEEARRRVGLSQ
FQYREDQPHWGFDSWNDFFTRRFRAGARPVAAPDDSHVIVSACEASPYHTESNLQLRDRF
WIKAQPYSLRDIFTPARLPLAERFVGGDLYQAYLSAYNYHRWHAPVRGTVTHAYRIDGTY
YSALDAEGEDPAGLNDSQGYMTAVAARAVVAIACDDPAIGTVAAVFVGMGDVSSCVIDVV
PGQHVDKGDEIGYFQYGGSTYCLLFEAGVIDRFLYAPPFDGDAPVVQVNSSVAIAR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacggaaacaaatcgcccgcggccacgcgccgacgtctcggcgcatggctggcg
ggcgaggaagcccacatggccgcctatcgccggcgcatcgcggccgacgcgcaggcccac
gccggcgaccggctgcgcacgccggccgtgcaggaactcgcgcggctgttcgacgacaac
gcggtgctgcagatgggcctgtcgcgcgcgatcgacgaggcgcgcgacgccggccacgac
ctcggctacggatcgatcggcgagctgatgaccgtgatcgaccacctgatgacctatacg
ccgccgttcagcgaagcgagcctgatcgtctgtccgctgaacgcgttcctcgaccggccg
atgtgcatgccgtccggctatccggtattccgcgacgcggccgtcaacgcgcacctgaag
cgcgtgctgaccgtctggtgcgactttctcggcggcccgcactcgcgcgtgcacctcgac
acgacgccgccggacgggtggttctgcgaagaagcgcgacggcgcgtcggcctgtcgcag
ttccagtatcgcgaggaccagccgcactggggcttcgactcgtggaacgatttcttcacg
cggcgttttcgcgccggcgcgcggcccgtcgccgcgcccgacgattcgcacgtcatcgtc
agcgcgtgcgaggcttcgccgtaccacaccgaatcgaacctgcagctgcgcgaccgcttc
tggatcaaggcgcagccgtactcgctgcgcgacatcttcacgccggcgcggctgccgctc
gccgagcgcttcgtcggcggcgacctctaccaggcctacctgagcgcctacaactaccat
cgctggcatgcgccggtgcgcggcaccgtcacgcatgcgtaccggatcgacggcacctac
tactcggcgctcgacgccgaaggggaggacccggccggactcaacgactcgcagggctac
atgacggccgtcgccgcgcgcgcggtcgtcgcgatcgcctgcgacgatccggcgatcggc
accgtggcggccgtgttcgttggaatgggcgacgtgtcgtcgtgcgtgatcgacgtggtg
ccgggccagcacgtggacaagggcgacgagatcggctatttccagtacggcggctcgacg
tactgcctgctgttcgaggccggcgtgatcgatcgctttctctacgcgccgccgttcgac
ggcgacgcgccggtcgtgcaggtcaattcgtcggtcgcgatcgcgcgctga

DBGET integrated database retrieval system