KEGG   Burkholderia pseudomultivorans: WS57_19265Help
Entry
WS57_19265        CDS       T04870                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    WS57_19265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpsl03011]
    WS57_19265
Ribosome [BR:bpsl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    WS57_19265
  Bacteria
    WS57_19265
  Archaea
    WS57_19265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AOI90947
UniProt: A0A132F0U3
Position
1:1515130..1515459
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcaaaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgatatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcggttcaccgcgcgcgccaagggccgcggcaaccgcattgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system