KEGG   Burkholderia pseudomultivorans: WS57_20115Help
Entry
WS57_20115        CDS       T04870                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WS57_20115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AOI91104
Position
1:1684213..1684587
Genome map
AA seq 124 aa AA seqDB search
MSQYQFTVSVKTSYLPEQSDPERRQYAFAYTLTIRNTGRVAAQLIARHWIITDSESHVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtatcagttcaccgtttcggtgaaaaccagctacctgccggaacaatccgac
cccgaacgccgtcaatatgcattcgcatacacgctgacgatccgcaacaccggacgggtc
gcggcgcagctgatcgcgcgtcactggatcatcacggacagcgaaagccacgtgcaggaa
gtgaaggggctcggcgtcgtcgggcaccagccgctgctgcagccgggcgaacagttcgag
tacacgagctgggcggtgatcgcgacgccggtcggcacgatgcgcggcgcgtatttctgc
gtggcggaggacggcgagcgtttcgaggcgccggtcgacgagttcgcgctgcacatgccg
cgcacgctgcattga

DBGET integrated database retrieval system