KEGG   Burkholderia pseudomultivorans: WS57_24795Help
Entry
WS57_24795        CDS       T04870                                 

Definition
(GenBank) gluconolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00053  Ascorbate and aldarate metabolism
bpsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    WS57_24795
Enzymes [BR:bpsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     WS57_24795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Lactonase Cytochrom_D1
Motif
Other DBs
NCBI-ProteinID: AOI93938
Position
1:complement(2710249..2711130)
Genome map
AA seq 293 aa AA seqDB search
MTHHAISICGDSRDALGECPLWDDRKQILYWIDSRACLVKARELATHTVREWTLPSQIGA
IALCESGRLLVALVDSFHFLDVDSGELTHFVDVTHPAPNMRLNDGRVDREGRLVLGSMAL
GRREPVGELYQLDGQGNLKVLETGICITNSTCFSPDGRYLYFSDSLSHQLRRYRYDTSAG
TLSERTLFVDTTSLKSGPDGAIIDAEGNLWTALVISGQLARFTADGRLDRIIDLPTVYPT
CPSIGGPALDTIFVTSISDSGNALRSANPNAGALVAVTGTGVRGLPECRFKDQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcacgccatcagcatttgcggcgactcgcgtgacgcgctgggcgaatgcccg
ctgtgggacgaccgcaagcagatcctgtactggatcgattcccgcgcgtgtctcgtgaag
gcgcgcgagctggcgacgcatacggttcgcgaatggacattgccttcgcagatcggcgcg
atcgcattgtgcgaaagcggtcgcctgctcgtcgcgctcgtcgacagcttccattttctc
gatgtcgatagcggcgagctcacgcacttcgtcgatgtgacgcacccggccccgaacatg
cgcctcaacgacggccgggtcgatcgcgaaggccgtctcgtcctcggttcgatggcgctc
gggcgccgcgaacccgtcggcgagttgtatcaactcgacggccagggcaacctgaaggtg
ctggagaccggtatctgcatcacgaactcgacatgcttctcgccagacggccggtatctg
tacttttcggacagcttgagccaccagctgcgtcgctaccgctacgacacctcggccggc
acgctgagcgagcgaacgctgttcgtggatacgacctcgctcaaatcgggccccgacggc
gccatcatcgatgccgaaggcaatctctggacggccctggtcatctcgggacaactggcc
cgcttcaccgccgacggcaggctggaccggattatcgacctgcctaccgtctatccgact
tgcccgtccatcggcgggccggctctcgacacgatcttcgtgaccagcatcagcgacagc
gggaatgcgctcaggagcgccaacccgaatgccggggcgctggtcgccgtgaccggtacg
ggtgtgcgcggcctgccggaatgccgcttcaaggatcagtga

DBGET integrated database retrieval system