KEGG   Burkholderia pseudomultivorans: WS57_27655Help
Entry
WS57_27655        CDS       T04870                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    WS57_27655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOI92459
UniProt: A0A132ER38
Position
1:complement(3341861..3342871)
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWMVATLVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAAFNVIAY
FIFHLKVAQTVGKGTIDPDIVDHYVVFGALVGAIGWNVITWYYGIPSSSSHALIGGLVGS
ALAKSGWSSLNLDGLMKTVAFIFISPLLGFILGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSAGLYSLGHGGNDAQKTIGIIWMLLIASGYASATSDAPPAWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAESGGAITLFIASFLGIPVSTTHTITGAIVGVGATQKLS
AVRWGVAGNIVWAWVLTIPASALIAAGGWWLGHRIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaactcgccctatggatggtcgcgacgctggtgctcgtcgcgctcgta
ttcgacttcatgaacggcttccacgacgcggcgaactcgatcgccacggtcgtgtccacc
ggcgtgctgaagccgcagcaggccgtcgtgttcgccgccgcgttcaacgtcatcgcgtac
ttcatcttccacctgaaggtcgcgcagacggtcggcaaaggcaccatcgaccctgacatc
gtcgaccactacgtcgtgttcggcgcgctggtcggcgcgatcggctggaacgtgatcacc
tggtactacgggatcccgtcgagctcgtcgcatgcgctgatcggcggcctcgtcggctcg
gcgctcgcgaagtcgggctggagctcgctgaacctcgacggcctgatgaagaccgtcgcg
ttcatcttcatttcgccgctgctcggcttcatcctcggctcgctgttcatgctcggcgtg
tcgtggctgtatttccgcaccgcgcccagcaaggtggaccggcgcttccgccggctgcag
ctgctgtcggccgggctgtacagcctcggacacggcggcaacgatgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcgtccggctatgcgtcggcgacgtccgatgcgccg
ccggcatgggtgatcggcgcgtgctacctgtcgatgggcctcggcacgctgttcggcggc
tggcgcatcgtgcgcacgatgggccagaagatcacgaagctcaagccggtcggcggcttc
tgcgcggaaagcggcggtgcgatcacgctgttcatcgcgtcgttcctcggcattccggtc
tcgaccacgcatacgattaccggcgcgatcgtcggcgtcggcgcgacgcagaagctgtcg
gccgtgcgctggggcgtggccggcaatatcgtgtgggcgtgggtgctgacgattccggcc
tccgcgctgatcgcagccggcggctggtggctcggacaccggatcttctga

DBGET integrated database retrieval system