KEGG   Burkholderia pseudomultivorans: WS57_30775Help
Entry
WS57_30775        CDS       T04870                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WS57_30775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpsl02000]
    WS57_30775
Enzymes [BR:bpsl01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     WS57_30775
Transporters [BR:bpsl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WS57_30775
   Histidine transporter
    WS57_30775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_13 AAA_15 APS_kinase AAA_33 Zeta_toxin ATPase_2 PRK G-alpha RsgA_GTPase RYDR_ITPR AAA_22 AAA_30 AAA_23 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AOI93021
UniProt: A0A132EZ82
Position
1:4004924..4005703
Genome map
AA seq 259 aa AA seqDB search
MNSQTQKLFVDDLHKRYGDNEVLKGVSLKANSGDVISVIGSSGSGKSTMLRCINFLEQPN
SGRIFVDGEEVRTALDKTGALRAADTKQLQRVRTKLSMVFQHFNLWSHMNVLENVMEAPV
NVLGIPKKEAEERARTYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGVPAE
VFANPKSERLRGFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccagactcagaagcttttcgtcgacgatctgcacaagcggtacggcgacaac
gaggtgctcaagggcgtgtcgctgaaggcgaactcgggcgacgtgatcagcgtgatcggc
tcgtccggctccggcaagagcacgatgctccgctgcatcaacttcctcgagcagccgaac
tcgggccgcatcttcgtcgacggcgaggaagtccgcaccgcgctcgacaagaccggcgcg
ctgcgcgcggccgatacgaagcagctgcagcgcgtgcgcaccaagctgtcgatggtgttc
cagcacttcaacctgtggtcgcacatgaacgtgctcgagaacgtgatggaagcgcccgtc
aacgtgctcggcatcccgaagaaggaagccgaggagcgcgcgcgcacctatctcgagaag
gtcggcctcgcgccgcgcgtcgagaagcagtatccgtcgcacctgtcgggcggccagcag
cagcgtgtcgcgatcgcgcgcgcgctcgcgatgcatcccgacgtgatgctgttcgacgag
cccacgtcggcgctcgatccggagctcgtcggcgaagtgctgaaggtgatgcagaagctg
gccgaggaaggccgcacgatgatcgtcgtcacgcacgagatgggcttcgcgcgcaacgtg
tcgaaccacgtgatgttcctgcaccaggggcgcgtcgaggaagaaggcgtgccggccgag
gtgttcgcgaacccgaagagcgagcgcctgcgcgggttcctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system