KEGG   Burkholderia pseudomallei MSHR511: BBQ_1013Help
Entry
BBQ_1013          CDS       T03012                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00010  Glycolysis / Gluconeogenesis
bpsm00020  Citrate cycle (TCA cycle)
bpsm00620  Pyruvate metabolism
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
bpsm01130  Biosynthesis of antibiotics
bpsm01200  Carbon metabolism
Module
bpsm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBQ_1013 (aceF)
   00020 Citrate cycle (TCA cycle)
    BBQ_1013 (aceF)
   00620 Pyruvate metabolism
    BBQ_1013 (aceF)
Enzymes [BR:bpsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BBQ_1013 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AHG35327
Position
1:1111027..1112670
Genome map
AA seq 547 aa AA seqDB search
MNQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSQGSLIVVLEASGGAAASAPQAAAPAPAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGE
YRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtaaaggtcggcgatgcg
gtgtcgcaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggccgcgccggctccggcgcccgcgccgcag
gccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgag
taccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgac
gtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcaccgcg
ttcgtgaaaggcgtgatgacgggacagcgcgcggcgcccggcgccgcggccgcgcccgcg
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaagcg
ctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccg
aacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcg
aaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatg
cagggcggctgcttctcgatctcgtcgcttggcgggatcggcggcacgcacttcacgccg
atcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtg
tgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgcc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system