KEGG   Burkholderia pseudomallei MSHR511: BBQ_1088Help
Entry
BBQ_1088          CDS       T03012                                 

Gene name
cysS
Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBQ_1088 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpsm01007]
    BBQ_1088 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpsm03016]
    BBQ_1088 (cysS)
Enzymes [BR:bpsm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BBQ_1088 (cysS)
Amino acid related enzymes [BR:bpsm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BBQ_1088 (cysS)
Transfer RNA biogenesis [BR:bpsm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BBQ_1088 (cysS)
 Prokaryotic Type
    BBQ_1088 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DUF5615 DUF3045
Motif
Other DBs
NCBI-ProteinID: AHG35547
Position
1:1189756..1191153
Genome map
AA seq 465 aa AA seqDB search
MESLRIYNTLARDKQDFVPRQPGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLRARG
YRVTYVRNITDIDDKIIRRAVENGETIQSLTRRFTDAMNADFDALGVERPDLEPRATEFI
PQMLGMIEKLEANGYAYQAKDGDVNYSVRKFANYGRLSGKSLEDLRAGERVAANDAKEDP
LDFVLWKRAKPQEPAGASWESKYGAGRPGWHIECSAMGCTLLGAHFDIHGGGQDLQFPHH
ENEIAQSEGATGQTFVNYWMHNGFVQVDSEKMSKSLGNFFTIREVLEKFDAEVVRFFIVR
THYRSPLNYSDVHLDDARASLTRLYTALKDATPDAQPLDWSEAHAQRFAAAMNDDFNTAV
AVAVLFELATEVNRTREPALARQLRLLAGLLGLLGREPREFLQHAAGAARTGALEPHEIE
ARIAARVAAKQAKNYAEADRIRAELLEAGIALEDKPGGSTEWRRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactgcgcatctacaacacgctcgcgcgtgacaagcaagacttcgtgccgcgg
cagcccggcgaagtgcggatgtacgtctgcgggatcaccgtctacgactattgccacatc
ggccatgcgcggatggtggtcgtgttcgacatcgtccagcgctggttgcgcgcgcgcggc
tatcgcgtgacatacgtgcgcaacatcaccgacatcgacgacaagatcatccgccgcgcg
gtcgagaacggcgagacgatccagtcgctcacgcgccgcttcaccgacgcgatgaacgcg
gatttcgacgcgctcggcgtcgagcggccggacctcgagccgcgcgcgaccgagttcatc
ccgcagatgctcgggatgatcgagaagctcgaggcgaacggttacgcgtatcaggcgaag
gacggcgacgtcaactattcggtgcgcaagttcgcgaactacggcaggctctccggcaag
tcgctcgaggatttgcgcgcgggcgagcgcgtcgccgcgaacgatgcgaaggaggatccg
ctcgacttcgtgctgtggaagcgcgcgaagccgcaggagccggcgggcgcgtcgtgggaa
tcgaagtacggcgcgggccgcccgggctggcacatcgaatgttcggcgatgggctgcacg
ctgctcggcgcacacttcgacattcacggcggcggccaggacctgcagttcccgcatcac
gagaacgagatcgcgcaaagcgagggtgcgaccggacaaactttcgtcaattattggatg
cacaacggtttcgtgcaggtcgatagtgagaagatgtcgaagtcgctcggcaacttcttc
acgatccgcgaagtgctcgagaagttcgacgccgaggtcgtgcgcttcttcatcgttcgc
acgcattaccgttcgccgctcaactacagcgacgttcatctcgacgacgcgcgcgcatcg
ctcacgcgcctttacacggcattgaaggacgcgacgccggatgcgcagccgctcgactgg
agcgaggcgcacgcgcagcgtttcgccgccgcgatgaacgacgatttcaacacggcggtc
gccgtcgccgtgctgttcgagctcgcgaccgaggtgaaccgcacacgcgagccggcgctc
gcgcgccagctcaggctgcttgcgggcctgctcggcctgctcggccgcgagccgcgcgaa
ttcctgcagcacgcggcgggcgccgcgcgcacgggcgcgctcgagccgcatgagatcgaa
gcgaggatcgccgcgcgcgtcgcggcgaaacaggcgaagaactatgccgaagcggaccgg
atccgcgcggaattgctcgaagccggaatcgcacttgaagacaaaccgggcggatcgacg
gagtggcgccgcgtatga

DBGET integrated database retrieval system