KEGG   Burkholderia pseudomallei MSHR511: BBQ_1190Help
Entry
BBQ_1190          CDS       T03012                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00540  Lipopolysaccharide biosynthesis
bpsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BBQ_1190 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bpsm01003]
    BBQ_1190 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpsm01005]
    BBQ_1190 (lpxB)
Enzymes [BR:bpsm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     BBQ_1190 (lpxB)
Glycosyltransferases [BR:bpsm01003]
 Polysaccharide
  Bacterial polysaccharide
   BBQ_1190 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:bpsm01005]
 Lipid A
  BBQ_1190 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2
Motif
Other DBs
NCBI-ProteinID: AHG35955
Position
1:1319668..1320834
Genome map
AA seq 388 aa AA seqDB search
MAFQLTPLRVALVAGEPSGDLLGASLLGGLHARLPASSRYYGIGGPRMSAVEFDAHWPME
KLAVRGYVEALKHIPEILRIRGELKRQLLAEPPDAFVGIDAPDFNFGLEQALRGAGIPTI
HFVCPSIWAWRGGRIKKIVKAVDHMLCLFPFEPELLEKAGVAATFVGHPLADEIPLEPDT
HGARIALGLPGGGPVIAVLPGSRRSEIELIGPTFFDAMELMQQREPGVRFVVPAATPALR
ELLQPLVDAHPSLSVTLTEGRAQVAMTAADAILVKSGTVTLEAALLKKPMVISYKVPWLT
GQIMRRQGYLPYVGLPNILAGRFVVPELLQHFATPDALADATLTQLRDDANRRALTDIFT
DMHLALRQNTAQRAAEAVARVIDSRKPR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccaactcacaccgctgcgcgtcgcgctcgtcgcgggcgagccgtcgggcgac
ctgctcggcgcgtcgctcctcggcgggctgcatgcgcggctgcccgcgtcgtcccgctac
tacgggatcggcgggccgcgcatgagcgccgtggaattcgatgcgcactggccgatggaa
aagctcgcggtgcgcggctacgtcgaggcgctcaagcacatccccgagatcctgcgcatt
cgcggcgaactcaagcgccagttgctcgccgagccgcccgacgcattcgtcggcatcgac
gcgcccgatttcaacttcggcctcgagcaggcgttgcgcggcgccggcattccgacgatc
cacttcgtctgcccgtcgatctgggcatggcgcggcggccggatcaagaagatcgtcaag
gccgtcgaccacatgctgtgcctgttcccgttcgagcccgaactgctcgagaaggcgggc
gtcgcggcgacgttcgtcggccatccgctggccgacgagattccgctcgagcccgatacg
cacggcgcgcggatcgcgctcgggctgccgggcggggggcccgtgatcgcggtgctgccg
ggcagccgccgctcggagatcgagttgatcggcccgacattcttcgacgcgatggaactg
atgcagcagcgcgagcccggcgtgcgcttcgtcgtgccggccgcgacgcctgcgctgcgc
gagttgctgcagccgcttgtcgacgcgcatccgtcgctgtcggtcacgctgaccgagggg
cgcgcgcaggtcgcgatgacggcggccgacgcgatcctcgtgaaaagcggcacggtgacg
ctcgaagcggcgctgctcaagaagccgatggtgatttcgtacaaggtgccatggctcacc
gggcagatcatgcgccggcagggctatctgccgtacgtcggcctgccgaacattctcgcg
ggccgcttcgtcgtgcccgagctgctgcagcatttcgcgacgcccgacgcgctcgccgac
gcgacgctcacgcaactgcgcgacgatgcgaaccgtcgcgcgctcaccgacattttcacc
gacatgcatctcgcgttgcgccagaataccgcgcagcgcgcggccgaggccgtcgcgcgc
gtgatcgacagcaggaagccgcgctga

DBGET integrated database retrieval system