KEGG   Burkholderia pseudomallei MSHR511: BBQ_1333Help
Entry
BBQ_1333          CDS       T03012                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bpsm  Burkholderia pseudomallei MSHR511
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBQ_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHG35964
Position
1:1471580..1472590
Genome map
AA seq 336 aa AA seqDB search
MHSIQLALWVVAALVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVVFAAAFNVIAY
FIFHLKVAQTVGKGTIDASIVDHYVVFGALFGAIGWNIITWYYGIPSSSSHALIGGLVGA
AVSKSGWGSLNVDGLMKTVAFIFISPLLGFILGSLFMLGVSWLYFRTAPSKVDRRFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIASGYASAASDAPPAWVIGACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFIASWMGIPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIVWAWVLTIPASALIAAAGWWIGHRVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaactcgccttgtgggtggtcgcggcgctcgtgctcgtcgcgctcgtg
ttcgatttcatgaacggttttcacgacgccgcgaactcgatcgcgaccgtcgtgtcgacc
ggggtgctcaagccccagcaagccgtcgtgttcgcggcggcgttcaacgtcatcgcgtat
ttcattttccacctgaaggtcgcgcagaccgtcggcaagggcacgatcgacgcgagcatc
gtcgatcattacgtcgtgttcggcgcgctgttcggcgcgatcggctggaacatcattacg
tggtactacgggattccgtcgagctcgtcgcacgcgctgatcggcgggctcgtcggcgcc
gcggtgtcgaaatcgggctgggggtcgctgaacgtcgacgggctgatgaagaccgtcgcg
ttcatcttcatctcgccgctgctcggcttcatcctcggctcgctgttcatgctcggcgtg
tcgtggctgtacttccgcaccgcgccgagcaaggtcgaccggcgcttcaggcggctgcaa
ctgctgtcggcgagcctgtacagtctcggccacggcggcaacgacgcgcagaagacgatc
ggcatcatctggatgctgctgatcgcatcgggctatgcatcggccgcgtccgacgcgcca
cccgcctgggtgatcggcgcatgctatctgtcgatgggcctcggcacgctgttcggcggc
tggcggatcgtgcgcacgatgggccagaagatcacgaagctcaagccggtcggcggtttc
tgcgcggaaacgggcggcgcgctcacgctgttcatcgcttcgtggatgggcattccggta
tcgaccacgcacacgatcaccggcgcgatcgtcggtgtcggcgcgacgcgcaagctgtcg
gccgtgcgctggggcgtcgcgggcaacatcgtgtgggcatgggtgctgacgattcccgcc
tcggcgctgatcgcggcggcgggctggtggatcgggcaccgggtgttctga

DBGET integrated database retrieval system