KEGG   Burkholderia pseudomallei MSHR511: BBQ_1406Help
Entry
BBQ_1406          CDS       T03012                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00071  Fatty acid degradation
bpsm00072  Synthesis and degradation of ketone bodies
bpsm00280  Valine, leucine and isoleucine degradation
bpsm00310  Lysine degradation
bpsm00362  Benzoate degradation
bpsm00380  Tryptophan metabolism
bpsm00620  Pyruvate metabolism
bpsm00630  Glyoxylate and dicarboxylate metabolism
bpsm00640  Propanoate metabolism
bpsm00650  Butanoate metabolism
bpsm00900  Terpenoid backbone biosynthesis
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
bpsm01130  Biosynthesis of antibiotics
bpsm01200  Carbon metabolism
bpsm01212  Fatty acid metabolism
bpsm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBQ_1406
   00630 Glyoxylate and dicarboxylate metabolism
    BBQ_1406
   00640 Propanoate metabolism
    BBQ_1406
   00650 Butanoate metabolism
    BBQ_1406
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBQ_1406
   00072 Synthesis and degradation of ketone bodies
    BBQ_1406
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBQ_1406
   00310 Lysine degradation
    BBQ_1406
   00380 Tryptophan metabolism
    BBQ_1406
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBQ_1406
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBQ_1406
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBQ_1406
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsm04147]
    BBQ_1406
Enzymes [BR:bpsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBQ_1406
Exosome [BR:bpsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBQ_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG33089
Position
1:1553347..1554528
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGASVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAVVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGITAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFAKEG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMLKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgagcgtgattcgcgcggtgctcgaacgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctgggccaggtgctgacggcgggc
tcgggccagaatccggcgcgccaggcgctgatcgcggcggggctgccgaacgcggtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgcttgccgcgaac
gcggtcgtcgcgggcgatgcggagatcgtcgtcgcgggcggtcaggagaacatgagcgcc
gcgcctcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagctcgtc
gacagcatgatcgtggatggcctctgggacgtctacaacaagtaccacatgggcatcacc
gcggagaacgtcgcgaaggagtacggcatcacgcgcgaggcgcaggaccagttcgccgca
ctctcgcagaacaaggcggaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccgatcgagatcccgcagagaaagggcgagccgctgcgtttcgcgaccgacgagttcgtg
cgtcacggcgtgacggccgagtcgctcgcgggcctgaagcccgcgttcgcgaaggagggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgaggcgctcggcctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcgtcgcgccgctgt
ctcgagcgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggttcacaagcagatgggctgggatacgtcgaaggtcaacgtg
aatggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgctcaagcgcgatgcgaaacgcggcctcgcatcgctttgcatc
ggcggcgggatgggcgtcgcgctcgcgctcgagcgtccgtaa

DBGET integrated database retrieval system