KEGG   Burkholderia pseudomallei MSHR511: BBQ_1574Help
Entry
BBQ_1574          CDS       T03012                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00260  Glycine, serine and threonine metabolism
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01120  Microbial metabolism in diverse environments
bpsm01130  Biosynthesis of antibiotics
bpsm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBQ_1574 (ltaA)
Enzymes [BR:bpsm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBQ_1574 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHG35352
Position
1:complement(1799793..1800863)
Genome map
AA seq 356 aa AA seqDB search
MIDFLSDTVTLPTAEMRHAMFTANVGDDCYGEDPTVNELESVAAGLTGKEAAAFVTSGTL
GNLSALLAQCPRGHEVILGDRSDLYNYEAGGVSLVGGAVLHPVETADDGSLPLERLRAAI
RDKRDPQCAPAAVIALENPHCLAGGRVLSLDYLRRVRALADEHGLAVHMDGARLFNAQAS
LGTPAAEIVAHVDSVQFCLSKSLAAPYGSMVCGSAALIDRVKRYRKLLGGGTRQAGIMAA
AGLVALRTMVARLADDHRRAARLAAELARIPGVALRSAVIETNMVFFDVAEPGNEAFLAA
LRDAGIRMGVLGDGVIRAVVHYMIDDDAISRTVDAVRAIVLPFAPALAPAAASQAQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttcctgagcgacacggtgacgctgccgaccgcggagatgcggcacgcgatg
tttaccgcgaatgtgggcgacgattgctacggcgaggatccgacggtcaacgagctcgaa
tcggtggcggccggactgaccggcaaggaagcggcggcgttcgtcacgagcggcacgctc
ggcaacctgagcgcgctgctcgcgcaatgcccgcgcgggcacgaggtgatcctcggcgat
cgctccgacctgtacaactacgaggcgggcggcgtgtcgctcgtcggcggcgcggtgttg
caccccgtcgagaccgccgacgacggcagcctgccgctcgagcggctgcgcgcggcgatc
cgcgacaagcgcgacccccagtgcgcgcccgccgcggtgatcgcgctcgagaatccgcat
tgcctcgccggcggccgcgtgctgtcgctcgactacctgcggcgcgtgcgcgcgctcgcc
gacgagcacgggctcgccgtgcacatggacggcgcgcgtctgttcaacgcgcaggcgagc
ctcggcacgccggcggccgagatcgtcgcgcacgtcgattcggtccagttctgcctgtcg
aagagcctcgccgcgccgtacggctcgatggtgtgcggcagcgccgccctgatcgatcgc
gtgaagcgctatcggaagctgctcggcggcggcacgcggcaagccggcatcatggcggcc
gccgggctcgtcgcgctgcgcacgatggtcgcgcggctcgcggacgatcaccgccgcgcg
gcgcgcctcgccgcggagctggcgcggattccgggcgtcgcgctgcgctcggcggtgatc
gagacgaacatggtgttcttcgacgtcgccgagccgggcaacgaggcgtttctcgccgcg
ctgcgcgacgcgggcatccggatgggcgtgctcggcgacggcgtgatccgggccgtcgtg
cactacatgatcgacgacgacgcgatcagccgcaccgtcgacgccgtccgcgcgattgtt
cttccgttcgccccggcgttagcgccggccgccgcatcgcaggcgcaatga

DBGET integrated database retrieval system