KEGG   Burkholderia pseudomallei MSHR511: BBQ_499
Entry
BBQ_499           CDS       T03012                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00051  Fructose and mannose metabolism
bpsm00520  Amino sugar and nucleotide sugar metabolism
bpsm00541  O-Antigen nucleotide sugar biosynthesis
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BBQ_499
   00520 Amino sugar and nucleotide sugar metabolism
    BBQ_499
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BBQ_499
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BBQ_499
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BBQ_499
SSDB
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Cupin_1
Other DBs
NCBI-ProteinID: AHG33249
Position
1:complement(531396..532823)
AA seq 475 aa
MNIHPVILCGGSGSRLWPMSRGGYPKQYLKLAGDRSLVQQTALRLRNIPDTTAPIVVTNN
EQRFLVAEQLRQVDITPSSIVLEPVGRNTAPAIAIAALLAMHDSPEALLLVLPSDHVILN
EPAFITAAREAAAIAADKHLVTFGITPTQAHTGFGYIRRGPLLADGGQAFKVDAFVEKPD
ASTAERFVRDSGYYWNSGMFMLKAATYMEELHRHAPEIARQAEFALASAKRDHDFLRLDA
DAFFACPNVSIDYAVMERTERAAVIATADLGWSDIGSWSALADIADTDAQGNALVGDVFT
DSVKNSYIRAEHRMIAALGLDDIVIVETADAVLVAHRDKAQDVRKIVEWLNASGRHESVT
HRRVVRPWGSYEGIDQGERFQVKRIVVNPGAQLSLQMHHHRAEHWIVVKGTALVTNDGKE
IILTENQSTYIPLGATHRLTNPGKIPLELIEVQSGSYLGEDDIVRFEDTYGRTST
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgaacattcatccggtcatcctgtgcggcggcagcggctcgcgtctttggcccatgtcg
cgcggcggctatcccaagcagtatctgaaactggccggcgatcgatccctggtccagcaa
accgcgctccgtttgcgcaacattccggatacgaccgcaccgatcgttgtcactaacaac
gaacagcgtttcctcgtcgcggaacaacttcgtcaggtcgatatcactccgtcgtcgatc
gtgctggaaccggtcggccgcaatactgcccccgccatcgcgatcgccgcgctgctcgcc
atgcacgactcgcccgaagcgctgctgctggtgctgccatcggaccacgtcatcctcaac
gagccggcattcatcacggcagcccgcgaggcagccgcgatcgcggcggacaagcacctc
gtcaccttcggcatcacacccacacaggcgcataccggcttcggttatatccggcgcggc
ccgctccttgccgacggtggacaagcgttcaaggtcgatgcattcgtcgagaagcccgac
gcgtcgaccgccgagcgcttcgtcagggacagcgggtactactggaatagcggcatgttc
atgctgaaagccgccacgtacatggaagaactgcatcgccatgcaccggaaattgcccgc
caggccgaattcgccctcgcttcagccaagcgcgaccacgattttcttcgtctcgacgct
gacgcattcttcgcgtgccccaatgtctcgatcgactacgccgtcatggaaaggaccgaa
cgtgctgctgtcatcgcgacggccgacctgggctggagcgacatcggatcgtggagcgca
cttgcggatatcgcggacaccgatgcgcagggtaacgccctcgtcggcgatgtattcacg
gactccgtcaagaactcatatattcgcgcggaacaccggatgattgccgccctcggcctc
gacgacatcgtgatcgtcgaaaccgccgacgccgtgctggtcgcgcatcgcgacaaggcc
caggacgtcaggaagatcgtcgagtggctgaatgcctccggccgccacgaatcggtcacg
catcgccgcgtcgtgcgcccgtggggttcctacgaaggcatcgaccagggcgagcgcttc
caggtgaagcgcatcgtcgtcaatccgggcgcgcaactgagcctgcagatgcatcatcat
cgcgccgagcactggatcgtcgtgaagggcaccgcgctcgtcacgaacgacggcaaggaa
atcatcctgaccgaaaatcagtccacctacattccgctcggcgcaacgcaccggctgacg
aatcccggcaagattccgctcgagctgatcgaggtgcagtccggctcgtatctcggcgaa
gacgacatcgtccgcttcgaggacacgtacgggcgcacgtcgacctga

DBGET integrated database retrieval system