KEGG   Burkholderia pseudomallei MSHR511: BBQ_499Help
Entry
BBQ_499           CDS       T03012                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00051  Fructose and mannose metabolism
bpsm00520  Amino sugar and nucleotide sugar metabolism
bpsm01100  Metabolic pathways
bpsm01110  Biosynthesis of secondary metabolites
bpsm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BBQ_499
   00520 Amino sugar and nucleotide sugar metabolism
    BBQ_499
Enzymes [BR:bpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BBQ_499
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BBQ_499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AHG33249
Position
1:complement(531396..532823)
Genome map
AA seq 475 aa AA seqDB search
MNIHPVILCGGSGSRLWPMSRGGYPKQYLKLAGDRSLVQQTALRLRNIPDTTAPIVVTNN
EQRFLVAEQLRQVDITPSSIVLEPVGRNTAPAIAIAALLAMHDSPEALLLVLPSDHVILN
EPAFITAAREAAAIAADKHLVTFGITPTQAHTGFGYIRRGPLLADGGQAFKVDAFVEKPD
ASTAERFVRDSGYYWNSGMFMLKAATYMEELHRHAPEIARQAEFALASAKRDHDFLRLDA
DAFFACPNVSIDYAVMERTERAAVIATADLGWSDIGSWSALADIADTDAQGNALVGDVFT
DSVKNSYIRAEHRMIAALGLDDIVIVETADAVLVAHRDKAQDVRKIVEWLNASGRHESVT
HRRVVRPWGSYEGIDQGERFQVKRIVVNPGAQLSLQMHHHRAEHWIVVKGTALVTNDGKE
IILTENQSTYIPLGATHRLTNPGKIPLELIEVQSGSYLGEDDIVRFEDTYGRTST
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatccggtcatcctgtgcggcggcagcggctcgcgtctttggcccatgtcg
cgcggcggctatcccaagcagtatctgaaactggccggcgatcgatccctggtccagcaa
accgcgctccgtttgcgcaacattccggatacgaccgcaccgatcgttgtcactaacaac
gaacagcgtttcctcgtcgcggaacaacttcgtcaggtcgatatcactccgtcgtcgatc
gtgctggaaccggtcggccgcaatactgcccccgccatcgcgatcgccgcgctgctcgcc
atgcacgactcgcccgaagcgctgctgctggtgctgccatcggaccacgtcatcctcaac
gagccggcattcatcacggcagcccgcgaggcagccgcgatcgcggcggacaagcacctc
gtcaccttcggcatcacacccacacaggcgcataccggcttcggttatatccggcgcggc
ccgctccttgccgacggtggacaagcgttcaaggtcgatgcattcgtcgagaagcccgac
gcgtcgaccgccgagcgcttcgtcagggacagcgggtactactggaatagcggcatgttc
atgctgaaagccgccacgtacatggaagaactgcatcgccatgcaccggaaattgcccgc
caggccgaattcgccctcgcttcagccaagcgcgaccacgattttcttcgtctcgacgct
gacgcattcttcgcgtgccccaatgtctcgatcgactacgccgtcatggaaaggaccgaa
cgtgctgctgtcatcgcgacggccgacctgggctggagcgacatcggatcgtggagcgca
cttgcggatatcgcggacaccgatgcgcagggtaacgccctcgtcggcgatgtattcacg
gactccgtcaagaactcatatattcgcgcggaacaccggatgattgccgccctcggcctc
gacgacatcgtgatcgtcgaaaccgccgacgccgtgctggtcgcgcatcgcgacaaggcc
caggacgtcaggaagatcgtcgagtggctgaatgcctccggccgccacgaatcggtcacg
catcgccgcgtcgtgcgcccgtggggttcctacgaaggcatcgaccagggcgagcgcttc
caggtgaagcgcatcgtcgtcaatccgggcgcgcaactgagcctgcagatgcatcatcat
cgcgccgagcactggatcgtcgtgaagggcaccgcgctcgtcacgaacgacggcaaggaa
atcatcctgaccgaaaatcagtccacctacattccgctcggcgcaacgcaccggctgacg
aatcccggcaagattccgctcgagctgatcgaggtgcagtccggctcgtatctcggcgaa
gacgacatcgtccgcttcgaggacacgtacgggcgcacgtcgacctga

DBGET integrated database retrieval system