KEGG   Burkholderia pseudomallei MSHR511: BBQ_5437Help
Entry
BBQ_5437          CDS       T03012                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00360  Phenylalanine metabolism
bpsm01100  Metabolic pathways
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BBQ_5437
Enzymes [BR:bpsm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     BBQ_5437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding GH3
Motif
Other DBs
NCBI-ProteinID: AHG36550
Position
2:complement(2437390..2438742)
Genome map
AA seq 450 aa AA seqDB search
METLDASTALPDFAAREDVLSVQDAKLARLGRRLAGSAAWRAHFRRAGLAPADLADRQSL
AALPLLEKVDARQHYPYPFLTVPLDRVVRFCATSGTTGLPVLFGFTRRDWEQTVVAQLGR
IFRTTGIVPGDRVYQGYGYGLWIGGASMDAALAAYGAVNFPVGPGRGELMIEWLRDHAYT
VTTMSPLWMMSLVTLARRAGIDPRRDWHLRVGLFGGQSVSASFRHELEAALPAGFAAHDI
YGTTEAGGPVLGVSCEHSRSANGMHLINDDSVLTEILDPHTLQPVEPGQTGEIVITTLDK
EASPVVRWRTRDLVRVADRPYDCPCGRSGFPLVSPIIGRSDDMLKVRGAMVYPSQIEEVI
TEAQGTVKEAWQIYIETERTSLDFIEVAIERTAGSLCTTQALAQEVQAKLRARLGLTCQV
VCHEEGTLPRYETKAIRVIERLRHANTKEK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggagacattagatgccagcacggccttgccggacttcgcggcgcgggaggatgtgctg
tcggttcaggatgcgaagctggcccggcttggacggagactcgctggatccgccgcatgg
cgggcgcatttccggcgcgcgggccttgctcccgcggatctcgccgaccggcagtcgctt
gccgcattgccgcttctcgagaaggtcgacgcgaggcaacactatccctatccgtttctg
acggtgccgctcgatcgcgttgtgcgcttctgtgcgacctcgggtacgacgggactgccg
gtcctgtttggtttcactcggcgggattgggaacagacggtcgttgcgcaactcgggcgc
attttcaggaccactggcattgtgccgggcgatcgggtctatcagggctacggctacggt
ctctggattggcggcgcgtcgatggatgctgctctggcagcgtatggcgcggtcaatttc
ccggttgggcccgggcgcggcgagctaatgatcgagtggctgcgggatcacgcctatacc
gtgaccacgatgtcgccgctctggatgatgagcctcgtcacgctcgcgcgccgtgcaggc
attgatccgcgaagggactggcacctacgcgtgggcctgttcggaggccagtcggtatcg
gcgtcgtttcgacatgaactggaggccgctttgcctgccggcttcgccgcgcacgacatc
tatggcacgacggaagcgggcggcccggtgctgggcgtttcatgtgagcactcccgcagc
gcaaacgggatgcatctgataaatgatgattcggtcctcaccgagatactggatccgcat
accttgcagcctgtcgaacccgggcagacgggcgagattgtcattacgacgcttgacaag
gaagcttccccggttgtgcggtggcgcacgcgtgatctggtccgggttgcagaccgtccg
tacgactgcccctgtggccgtagtggttttccgttggtcagcccgatcatcgggcgctcc
gatgacatgctcaaggtgcgtggagcgatggtgtacccgtcgcagatcgaagaagtgatc
acggaggcgcagggcaccgtcaaggaggcatggcagatctacatcgaaaccgagcgtacc
agcctcgacttcatcgaagtggcgatagagcgcacggcaggcagcctctgcacgactcag
gcacttgcacaggaagtgcaggcaaagctccgggcgcgccttggtctgacgtgccaggtg
gtctgccatgaagaaggcacgctgccgaggtacgaaaccaaggcaatccgcgtgatcgag
cggctgcgccatgcgaacacgaaggagaagtga

DBGET integrated database retrieval system