KEGG   Burkholderia pseudomallei A79A: X996_1770Help
Entry
X996_1770         CDS       T03498                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    X996_1770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpso02000]
    X996_1770
Transporters [BR:bpso02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    X996_1770
   Histidine transporter
    X996_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIV94718
Position
1:1970194..1970883
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPLIWAGTVQTIELSVLSLAAAVLLGLVGAVAKLSHNRVLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIWLNQFTDLMSWDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLAV
PRGQLEAGSAYGMNGMRVFARIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADIVKA
AQDAGKSTFNMFFFILVAALIYLAITTASNLVLGQLEKRYSIGVRHAEL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctatacggctttggcccgctcatctgggcgggcaccgtgcagacgatcgagctg
tcggtgctgtcgctcgcggcggcggtgctgctcggcctcgtcggcgcggtcgcgaagctc
tcgcacaatcgcgtgctgcgcgcgatcgcgacgggctacacgacgctcattcgctcggtg
cccgatctcgtgctgatgctgctgctgttctacagtatccagatctggctcaatcagttc
accgatctgatgagctgggatcagatcgatatcgatccgttcgtcgccggcgtgctgacg
ctcgggttcatttacggcgcgtacttcaccgaaacctttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgaacgggatgcgcgtgttcgcg
cgaatcatgtttccgcagatgatgcgcttcgcgctgccgggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcggtctggccgacatcgtcaaagcc
gcgcaggacgcgggcaagagcacgttcaacatgttcttcttcattctcgtcgcggcgctc
atctacctggcgatcacgacggcctccaatctcgtgctcgggcaactcgagaaacgttat
tccatcggcgtgaggcacgcggaactatga

DBGET integrated database retrieval system