KEGG   Burkholderia pseudomallei A79A: X996_1980Help
Entry
X996_1980         CDS       T03498                                 

Gene name
dehII
Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00361  Chlorocyclohexane and chlorobenzene degradation
bpso00625  Chloroalkane and chloroalkene degradation
bpso01100  Metabolic pathways
bpso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    X996_1980 (dehII)
   00361 Chlorocyclohexane and chlorobenzene degradation
    X996_1980 (dehII)
Enzymes [BR:bpso01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     X996_1980 (dehII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AIV96468
Position
1:complement(2230616..2231398)
Genome map
AA seq 260 aa AA seqDB search
MPGTPPAFPKAILFDAYGTLFDVHAVVAAAEQLFPGRGDALSQLWRRKQIEYSQLRTLAD
PAGGRYRPFWELTLDALRFAARALGLALSAAAEKRLMDEYACLSTYPDTVPTLRALRARS
TPPKLAILSNGNPQMLDIAVKSAGMSGLFDRVLSVDAVRAYKPSPAAYALGTAAFDAAPA
DIAFVSSNGWDVAGAGWFGYRTFWLNRTGAPLEELGAAPAGTGTGMAELLAFLDAPRAAA
KAGGRARPAPRVSRLGTPPT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaccccgcccgccttcccgaaggcgattctcttcgacgcgtacggcacgctg
ttcgacgtgcacgcggtcgtcgccgcggccgagcagctgtttccggggcgcggcgacgcg
ctgtcgcagctctggcggcgcaagcagatcgaatattcgcaactgcgcacgctcgccgat
ccggcgggcgggcgctatcggccgttctgggagctgacgctcgacgcgctgcgctttgcc
gcgcgcgcgctcggcctcgcgctgtccgcggccgccgagaaaagactgatggacgagtat
gcgtgcctgtcgacgtacccggacacggtgccgacgctgcgcgcgctgcgtgcgcgcagc
acgccgccgaagctcgcgatcctgtcgaacggcaatccgcagatgctcgatatcgcggtc
aagagcgccgggatgagcggcctgttcgaccgcgtgctgtccgtcgacgcggttcgcgcg
tacaagccgtcgcccgccgcgtatgcgctcggcaccgcggcgttcgacgcggcccccgcc
gacatcgcgttcgtgtcgtcgaacggctgggacgtcgcgggcgccggctggttcggctac
cggaccttctggctgaaccgcacgggcgcgccgctcgaggagctcggcgcggcgcccgcg
ggcacgggcaccggcatggccgaactgctcgcctttctcgacgcgccgcgcgccgccgcg
aaagcgggcggccgagcgcgcccggcgccccgcgtaagccgcctcggcacgccgccgacc
tga

DBGET integrated database retrieval system