KEGG   Burkholderia pseudomallei A79A: X996_2247Help
Entry
X996_2247         CDS       T03498                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00071  Fatty acid degradation
bpso00072  Synthesis and degradation of ketone bodies
bpso00280  Valine, leucine and isoleucine degradation
bpso00310  Lysine degradation
bpso00362  Benzoate degradation
bpso00380  Tryptophan metabolism
bpso00620  Pyruvate metabolism
bpso00630  Glyoxylate and dicarboxylate metabolism
bpso00640  Propanoate metabolism
bpso00650  Butanoate metabolism
bpso00900  Terpenoid backbone biosynthesis
bpso01100  Metabolic pathways
bpso01110  Biosynthesis of secondary metabolites
bpso01120  Microbial metabolism in diverse environments
bpso01130  Biosynthesis of antibiotics
bpso01200  Carbon metabolism
bpso01212  Fatty acid metabolism
bpso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X996_2247
   00630 Glyoxylate and dicarboxylate metabolism
    X996_2247
   00640 Propanoate metabolism
    X996_2247
   00650 Butanoate metabolism
    X996_2247
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X996_2247
   00072 Synthesis and degradation of ketone bodies
    X996_2247
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X996_2247
   00310 Lysine degradation
    X996_2247
   00380 Tryptophan metabolism
    X996_2247
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X996_2247
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X996_2247
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X996_2247
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpso04147]
    X996_2247
Enzymes [BR:bpso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X996_2247
Exosome [BR:bpso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X996_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIV97025
Position
1:2528934..2530118
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGIAQHAPALTVNRLCGSGLQAIVSAAQNVLLGDADIAVAGGAENM
SRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRHDASLDDFTKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcacggcgatcggcgatttcggcggc
agcctgaaggacttcgcgccgaccgagctcggcgcgcgggtcgtgcgcgaggtgctgtcg
cgcgcgcaggtgtcgggcgacgaggtcggccacgtcgtgttcggcaatgtcgtgcacacg
gagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcatcgcgcagcac
gcgcccgcgctgacggtcaaccgtctctgcggctccggcctgcaggcgatcgtgtcggcc
gcgcagaacgtgctgctcggcgacgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtactcggtgccggccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggccgagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcccaccggcgcgcgtcgcatgcgacgaaatccggctatttcaaggatcagatc
ctgccgatcgagatcgcgtcgcgcaagggcacggtcgtgttcgacgccgacgagcacgtg
cgccacgacgcgtcgctcgacgacttcacgaagctcaagcccgtgttcgccaaggagaac
ggcacggtgacggcgggcaacgcgtcgggcatcaacgatgcggccgccgcggtggtgctg
atggagcgcggcgtcgccgacaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcacgcgggcgtcgatccggcatacatgggcatcggccccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcaccgtcgccgatctcgacgtgatcgaggcgaacgaggcg
ttcgccgcgcaggcgtgcgcggtgtcgaacgcgctcggtctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctgtacgagctgcagcggatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system