KEGG   Burkholderia pseudomallei A79A: X996_3382Help
Entry
X996_3382         CDS       T03498                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00010  Glycolysis / Gluconeogenesis
bpso00071  Fatty acid degradation
bpso00350  Tyrosine metabolism
bpso00625  Chloroalkane and chloroalkene degradation
bpso00626  Naphthalene degradation
bpso00680  Methane metabolism
bpso01100  Metabolic pathways
bpso01110  Biosynthesis of secondary metabolites
bpso01120  Microbial metabolism in diverse environments
bpso01130  Biosynthesis of antibiotics
bpso01200  Carbon metabolism
bpso01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X996_3382
  09102 Energy metabolism
   00680 Methane metabolism
    X996_3382
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X996_3382
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    X996_3382
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    X996_3382
   00626 Naphthalene degradation
    X996_3382
Enzymes [BR:bpso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     X996_3382
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     X996_3382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C Met_10 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N RTC4
Motif
Other DBs
NCBI-ProteinID: AIV95419
Position
1:complement(3897604..3898710)
Genome map
AA seq 368 aa AA seqDB search
MKTKAAIAWKAGEPLTIEEVDLEGPRAGEVLIEVKATGICHTDYYTLSGADPEGIFPAIL
GHEGAGVVVDVGPGVGTLKKGDHVIPLYTPECRECKFCLSRKTNLCQKIRATQGRGLMPD
ATSRFSVGGKPIFHYMGTSTFSNYIVVPEIAVAKVREDAPFDKICYIGCGVTTGVGAVVY
SAKVEAGANVVVFGLGGIGLNVIQGARMVGADKIIGVDLNPKRVELARKFGMTHFINPNE
VENVVDHIVQLTDGGADYSFECIGNVKVMRQALECTHKGWGQSFIIGVAAAGEEISTRPF
QLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLITHTLPLEKINEGFELMKKGE
SIRSVVLY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaagccgcgatcgcctggaaggcgggcgaaccgctgacgatcgaagaggtc
gatctcgaaggaccgcgcgcaggcgaggtcctgatcgaagtgaaggccaccggcatctgc
cacaccgattattacaccctctcgggcgcggaccccgagggcatcttcccggcgatcctc
gggcacgagggcgcgggcgtcgtcgtcgacgtcgggccgggcgtcggcacgctgaagaag
ggcgatcacgtgattccgctctacacgcccgaatgccgcgagtgcaagttctgcctgtcg
cgcaagacgaacctgtgccagaagatccgcgcgacccaaggccgcggcctgatgcccgac
gcgacgtcgcgcttctcggtcggcggcaagccgatcttccactacatgggcacgtccacg
ttctcgaactacatcgtggtgccggagatcgcggtcgcgaaggtgcgcgaggacgcgccg
ttcgacaagatctgctacatcggctgcggcgtgacgacgggcgtcggcgcggtcgtctac
tcggcgaaggtcgaggcgggcgcgaacgtcgtcgtgttcggcctcggcggcatcggcctg
aatgtgatccagggcgcgaggatggtgggcgcggacaagatcatcggcgtcgatctcaac
ccgaagcgcgtcgagctcgcgaggaagttcggcatgacgcacttcatcaacccgaacgaa
gtcgagaacgtcgtcgaccacatcgtgcagttgacggacggcggcgccgattattcgttc
gaatgcatcggcaacgtgaaggtgatgcgccaggcgctcgagtgcacgcacaagggttgg
gggcagtcgttcatcatcggcgtcgcggcggccggcgaggaaatcagcacgcggccgttc
cagctcgtgaccggccgcgagtggaagggctccgcgttcggcggcgcgcgcgggcgcacc
gacgtgccgaagatcgtcgactggtacatggaaggcaagatcaacatcgacgacctgatc
acgcacacgctgccgctcgagaagatcaacgaaggcttcgagctgatgaagaagggcgaa
tcgatccgctcggtcgtgctgtactga

DBGET integrated database retrieval system