KEGG   Burkholderia pseudomallei A79A: X996_5549Help
Entry
X996_5549         CDS       T03498                                 

Definition
(GenBank) deoxyribonuclease II family protein
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
bpso  Burkholderia pseudomallei A79A
Brite
Enzymes [BR:bpso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     X996_5549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-ProteinID: AIV93723
Position
2:complement(2668448..2669500)
Genome map
AA seq 350 aa AA seqDB search
MTISPRDEQNRSVDLWFAYKVPKLTKDTDSDSATGYEYVYYDREIGSVQKSPNRMNNPKG
ALFYTLDSIFGDPGSTTGWILYNDEMPADADRSNNATLGHTKGVIAFDIASNSALWLLHS
WPKYTSPSAPGVPTPLYGQTFLCVSLDLETAGKIAAQMALHQQPQVYLPRTAGLDHASPL
YTLTQPLNASAPGDSDSLDFKTRGGAPFKVIAKNRKWGKDFWNDLVGPTLKADMDVETWI
RGKIPPILDSDGVHKTYDIKFIDLRKLGAPWAWPETQDHAKWGITTTDDWVCVGDINRMV
TQEKRGGGTIAFQDPQLWKALSQTDLIVPPPGKTEAQARAMIHRTHQPAD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactatctcgccgcgcgacgaacagaatcgatcggtcgatctatggttcgcctacaaa
gtgccgaagctcacgaaggataccgacagcgacagcgcaaccggctatgaatacgtgtat
tacgatcgcgaaatcgggtcggtgcagaagtcgccgaatcggatgaacaacccgaaaggg
gcgctgttctacacactcgattcgatcttcggcgatccgggcagcacgacgggctggatt
ctctacaacgacgaaatgccggccgatgcggaccgttcgaacaacgcgacgctcggccat
acgaaaggcgtgatcgccttcgacatcgcgtcgaactccgccttgtggctgctgcactcg
tggccgaaatacacgagcccgtcggcccccggcgtgccgacgccgctgtacgggcagacg
ttcctgtgtgtgagcctcgatctcgagacggccggcaagatcgccgcgcagatggcgctg
catcagcagccgcaggtctacctgccgcgcaccgccgggctcgatcacgcgagcccgcta
tacacgctcacgcagccgctcaacgcgtccgcgcccggcgattcggattcgctcgacttc
aagacccgcggcggcgcgccgttcaaggtgatcgcgaagaatcgcaagtggggcaaggat
ttctggaacgatctcgtcggcccgacgctgaaggccgacatggacgtcgagacatggatc
cgcggcaagatcccgcccattctcgactccgacggcgtgcacaagacctacgacatcaag
ttcatcgatctgcgcaagctcggcgcgccatgggcatggcccgaaacgcaggaccatgcg
aaatggggcatcacgacgaccgacgactgggtgtgcgtcggcgatatcaatcgaatggtg
acgcaggaaaagcgcggcggcggcacgatcgccttccaggatccgcaattgtggaaggcg
ctgtcgcagaccgatctgatcgtgccgccgcccggcaagaccgaagcgcaggcgcgcgcg
atgatccatagaacgcaccagccggccgactag

DBGET integrated database retrieval system