KEGG   Burkholderia pseudomallei A79A: X996_5671Help
Entry
X996_5671         CDS       T03498                                 

Definition
(GenBank) thiJ/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    X996_5671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpso01002]
    X996_5671
Enzymes [BR:bpso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     X996_5671
Peptidases [BR:bpso01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   X996_5671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIV93071
Position
2:2818468..2819166
Genome map
AA seq 232 aa AA seqDB search
MTIEVGLLLFPQVQQLDLTGPHDVFASLPGVTVRLVWKTREPVASSSGLVLAPNATFDDC
PPLDVICVPGGIGVADLMEDADTLAFLRRHAAHARYVSSVCTGALVLGAAGLLRGRRATT
HWAFHSLLAPFGATPVRERVVRDGNLVTGGGVTAGIDFALTLAAELVGEDDAQAVQLQLE
YAPAPPFAAGDPDTAPARIVERMRERSKPVLARREQVVARAVAALERRRADG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaagtgggattactgttgtttccgcaggtgcagcagctcgacctgaccggc
ccgcacgacgtgttcgcatcgctgcccggcgtcacggtgcggctcgtgtggaaaacgcgc
gagccggtggcgtcgagcagcgggctcgtgcttgcgccgaacgcgacgttcgacgattgc
ccgccgctcgatgtgatttgcgtgccgggcggcatcggcgtcgccgatctgatggaggat
gcggacacgctcgcgtttttgcgccggcacgcggcgcatgcgcgctacgtgagctcggtg
tgcacgggcgcgctcgtgctcggcgcggcggggctgctgcgcgggcggcgcgcgacgacg
cactgggcgttccattcgctgctcgcgccgttcggcgcgacgccggtacgcgagcgcgtc
gtgcgcgacggcaatctcgtgacgggcggcggcgtgaccgcggggatcgatttcgcgctg
acgctcgcggccgagctcgtcggcgaggacgatgcgcaggcggtgcagttgcagctcgaa
tatgcgccggccccgccgttcgcggcgggcgatccggataccgcgccggcgcggatcgtc
gagcgcatgcgcgagcggtcgaagccggtgctcgcgcggcgcgagcaggtggtcgcgcgc
gccgtggcggcgctcgagcggcggcgcgccgacgggtga

DBGET integrated database retrieval system