KEGG   Burkholderia pseudomallei A79A: X996_8Help
Entry
X996_8            CDS       T03498                                 

Definition
(GenBank) gamma-glutamyltranspeptidase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00430  Taurine and hypotaurine metabolism
bpso00460  Cyanoamino acid metabolism
bpso00480  Glutathione metabolism
bpso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    X996_8
   00460 Cyanoamino acid metabolism
    X996_8
   00480 Glutathione metabolism
    X996_8
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpso01002]
    X996_8
Enzymes [BR:bpso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     X996_8
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     X996_8
Peptidases and inhibitors [BR:bpso01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   X996_8
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIV95990
Position
1:complement(8957..10621)
Genome map
AA seq 554 aa AA seqDB search
MNLHSNLSGAPFSWRNPYPTTRVPVFARNVVSTSHPLAAQAGLRMLWKGGNAVDAAIAAA
AAITVVEPVSCGLGGDAFALVWDGAKLHGLNASGVAPAAWSVDYFRRRHGEAGNGLARQP
VRGWDTVTVPGVIAGWEALHAKFGTLPFADLLEPAIELAERGHAVAAVVAHKWAAAVPEL
SGQPGFAQTFMPHGRAPEVSERVRLPGHARTLRTIAAEGARAFYEGSLAESIAAFFRDGG
GALTLDDLRAYRPEWVEPIGKDFRGYTVHEIPPNGQGIAALIALGIVERFGLDDLPLDSA
QAQHVQIEAMKLAFADVYRYVADPRAMELTPAQMLDDAYLAARAKLIDPRRATHFSFGMP
RAGGTIYLSAADERGMMVSFIQSNYMGFGSGLVVPGTGIALQNRGCGFSMDPASPNVVAG
GKRPFHTIIPAFVTQQAGSARHAVMSFGVMGGDMQPQGHLQTIVRMLGYGQQPQAACDAP
RWKVSRSFTLDVEATFDASVVEALAARGHTIQAIDDPYMDFGSGQFIWRLDRDEPDRGYV
AASDSRRDGLAAGF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcattcgaacctgtccggcgcgccgttctcgtggcgcaatccgtatccgacg
acgcgcgtgccggtgttcgcgcgcaacgtcgtgtcgacgtcgcatccgctcgccgcgcag
gcggggctcaggatgctgtggaagggcggcaacgccgtcgacgcggcgatcgccgcggcg
gcggcgatcaccgtcgtcgagccggtgtcgtgcggcctcggcggcgacgcgttcgcgctc
gtctgggacggcgcgaagctgcatggcctgaacgcgtcgggcgtcgcgcccgccgcatgg
agtgtcgactattttcgccggcggcacggcgaggcgggcaacggtctcgcgcggcagccg
gtgcgcggctgggacacggtgacggtgcccggcgtgatcgccggctgggaggcgctgcat
gcgaagttcggcacgctgccgttcgccgatctgctcgagccggcgatcgagcttgccgag
cgcgggcacgcggtggccgcggtggtcgcgcacaagtgggcggccgccgtgccggagctg
agcggccagccgggcttcgctcaaaccttcatgccgcacggccgcgcgcccgaagtgagc
gagcgggtgcggctgccgggccatgcgaggacgctgcgcacgatcgcggccgaaggcgcg
cgcgcgttctacgaaggcagcctcgccgagtcgatcgccgcgttcttccgcgacggcggc
ggcgcgctcaccctcgacgacctgcgcgcgtaccgccccgagtgggtcgagccgatcggc
aaggacttccgcggctacacggtgcacgagattccgccgaacggccaggggatcgccgcg
ctgatcgcgctcggcatcgtcgagcgcttcggcctcgacgatttgccgctcgattcggcg
caggcgcagcatgtgcagatcgaggcgatgaagctggcgttcgccgacgtctatcgctac
gtcgccgatccgcgtgcgatggaactcacgcccgcgcagatgctcgacgacgcgtacctc
gccgcgcgcgcgaagctgatcgaccctcggcgcgcgacgcatttctcgttcggcatgccg
cgcgcgggcggcacgatctacctgtcggcggccgacgagcgcgggatgatggtgagcttc
atccagtcgaactacatgggtttcggctcgggcctcgtggtcccgggcacggggattgcg
ctgcagaaccgcggctgcgggttctcgatggatccggcttcgccgaacgtcgtcgcgggc
ggcaagcggccgttccacacgatcattccggcgttcgtcacgcagcaggcgggcagcgcg
cggcacgcggtgatgagcttcggcgtgatgggcggcgacatgcagccgcaaggccatctg
cagacgatcgtgcggatgctcggctacggccagcagccgcaggccgcgtgcgacgcgccg
cgctggaaggtgagccgctcgtttacgcttgatgtcgaggccacgttcgatgcgtccgtc
gtcgaggcgctcgccgcgcgcggccatacgatccaggcgatcgacgatccgtacatggac
ttcggctccggccagttcatctggcggctcgatcgcgacgagcccgaccgcggctatgtc
gcggcgagcgacagccggcgcgacggcctcgcggccggcttctga

DBGET integrated database retrieval system