KEGG   Burkholderia pseudomallei MSHR146: BBN_1034Help
Entry
BBN_1034          CDS       T03024                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00562  Inositol phosphate metabolism
bpsu00564  Glycerophospholipid metabolism
bpsu01100  Metabolic pathways
bpsu01110  Biosynthesis of secondary metabolites
bpsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBN_1034
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBN_1034
   00565 Ether lipid metabolism
    BBN_1034
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBN_1034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpsu02042]
    BBN_1034
Enzymes [BR:bpsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BBN_1034
Bacterial toxins [BR:bpsu02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BBN_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AHG68918
Position
1:complement(1121115..1123217)
Genome map
AA seq 700 aa AA seqDB search
MTNQNRRDFLRLAAGTAGAAALQLFPPVIREALAIPANRRTGTIRDVEHIVILMQENRSF
DHYFGKLRGVRGFGDPRPLALQNGKSVFHQPVLLGPAELLPFHPDASNLGMQFLQDLPHG
WQDMHGAWNKGRYDRWIANKGTTTMAYLERDDIPFHYQLADAFTICDAYHCSIPSSTDPN
RYYMWTGYVGNDGAGGGPVLGNEEAGYGWSTYPETLEQAGVSWKIYQDIGTGLDAAGSWG
WTQNPYIGNYGDNSLLYFNQYRNAQPGSPLYDKARTGTNVSAGGTLFDVLQQDVQNGTLP
QVSWICAPEAYSEHPNWPANYGAWYVEQVLKALTSNPDVWSKTALFITYDENDGFFDHVA
PPFAPQSHENGLSTVSTAGEIFAGDATHMAGPYGLGPRVPMLVVSPWTKGGWVCSQTFDH
TSLLQFIEARFNDRYSVRAPNVTPWRRAVCGDLTSAFNFSSPDGSWPQLPDTSGYAPPDR
NRHPSYVPVPPAAQSMPKQEAGLRAARALPYELFVLGRIDQSTGKFKLTFANTGRAGAAF
QVTAGNRLDGPWAYTVEARKRLSDEWSTALTLSIYDLTVYGPNGFLCQFRGSTAAALGLS
ANPEVIYGYDVANGNITLRLSNRGRAAVRLTVTNAYGNAAPRVYELKPGQRINDYWDLRD
SHSWYDLSVSDGAPNGFLRRFAGHVETGRPSTSDPLIATA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcagaatcgccgggactttctgcgcctcgccgccggcacggcgggcgcggcc
gcgctgcagctctttccgcccgtgatccgcgaagcgctcgcgattcccgcgaaccgccgc
accggcacgatccgcgacgtcgagcacatcgtgatcctgatgcaggaaaaccgctcgttc
gatcattacttcggcaagctgcgcggcgtgcgcggcttcggcgatccgcgcccgctcgcg
ctgcagaacggcaagtcggtgttccatcagccggtgctcctcggcccggccgagctgctg
ccgttccatccggacgcgtcgaatctcggcatgcagttcctgcaggatctgccgcacggc
tggcaggacatgcacggcgcatggaacaaggggcgctacgaccgctggatcgcgaacaag
ggcacgacgacgatggcctacctcgagcgcgacgacatcccgttccactaccagctcgcc
gacgcgttcacgatctgcgacgcgtaccactgctcgatcccgagctcgaccgacccgaac
cgctactacatgtggacgggctacgtcggcaacgacggcgcgggcggcggcccggtgctc
ggcaacgaggaggccggctacggctggagcacgtatccggagacgctcgagcaggcgggc
gtgtcgtggaagatctatcaggacatcggcacgggcctcgacgcggcgggctcgtggggc
tggacgcagaacccgtacatcggcaactacggcgacaattcgctcctctatttcaaccag
taccgcaacgcgcagccgggcagcccgctgtacgacaaggcgcgcacgggcacgaacgtg
agcgcgggcggcaccctgttcgacgtgttgcagcaggacgtgcagaacggcacgctgccg
caggtgtcgtggatctgcgcgccggaagcgtattccgagcacccgaactggccggcgaac
tacggcgcgtggtacgtcgagcaggtgctgaaggcgctgacgtcgaacccggacgtctgg
agcaagaccgcactcttcatcacgtacgacgaaaacgacggcttcttcgatcacgtcgcg
ccgccgttcgcgccgcaatcgcacgagaacggactgtcgacggtgtcgaccgcgggcgag
atcttcgcgggcgacgccacgcacatggccgggccgtacgggctcggaccgcgcgtgccg
atgctcgtcgtgtcgccgtggacgaagggcggctgggtctgctcgcagacgttcgatcac
acgtcgctgctgcaattcatcgaggcgcgcttcaacgatcgctactcggtgcgcgcgccg
aacgtgacgccgtggcgccgcgcggtgtgcggcgatctcacgtccgcgttcaacttctcg
agcccggacggcagctggccgcaactgcccgacacgagcggctacgcgccgcccgatcgc
aaccgccatccgagctacgtgccggtgccgcccgccgcgcagtcgatgccgaaacaggag
gccggcctgcgcgccgcgcgcgcgctgccgtacgagctcttcgtgctcggccgcatcgat
cagtcgaccggcaagttcaagctgaccttcgcaaacacgggccgggcgggcgcggcgttc
caggtgacggccggcaaccgcctcgacggcccgtgggcgtatacggtcgaagcgcgcaag
cggctgtccgacgaatggagcacggcgctcacgctgagcatctacgatctgaccgtctac
ggcccgaacggcttcctgtgccagttccgcggctcgaccgcggcagcgctcggcttgagc
gcgaacccggaggtgatctacggctatgacgtcgcgaacggcaacatcacgctgcgcctg
tcgaaccgcggccgcgcggcggtgcggctcacggtcacgaacgcgtacggcaacgcagcc
ccgcgcgtctacgagctgaagcccggccagcggatcaacgactactgggatctgcgcgac
agccacagctggtacgacctgagcgtctccgacggcgcgccgaacggcttcctgcgccgc
ttcgcgggacacgtcgagacgggccggccgagcacgagcgatccgctgatcgcgacggcc
tga

DBGET integrated database retrieval system