KEGG   Burkholderia pseudomallei MSHR146: BBN_1169Help
Entry
BBN_1169          CDS       T03024                                 

Gene name
kdsA
Definition
(GenBank) 3-deoxy-8-phosphooctulonate synthase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00540  Lipopolysaccharide biosynthesis
bpsu01100  Metabolic pathways
Module
bpsu_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BBN_1169 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpsu01005]
    BBN_1169 (kdsA)
Enzymes [BR:bpsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     BBN_1169 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:bpsu01005]
 Unusual sugar
  BBN_1169 (kdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AHG66672
Position
1:1291199..1292053
Genome map
AA seq 284 aa AA seqDB search
MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSS
GKSFRGLGMDEGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFI
RACAQSGKPVNIKKGQFLAPHDMKNVIDKARDAARDAGLSEDRFMACERGVSFGYNNLVS
DMRSLAIMRETGAPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAALATGVAGLFMETH
PNPAEAKSDGPNAVPLGRMAALLETLVTLDRAVKRVPFLENDFN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgccgggttcgaagtcgggctcgacaagccgttcttcctgatcgccggcacc
tgcgtcgtcgaatcggagcagatgacgatcgacaccgcgggccggctgaaggagatctgc
gcgacgctcggcgtgccgttcatctacaaatcgtcgtacgacaaggccaatcgcagctcg
ggcaagtcgtttcgcgggctcgggatggacgaggggctgcggattctcgccgaggtgaag
cgccagctgaacgtgccggtgctcaccgacgtgcacgagatcgacgagatcgcgcccgtg
gcggccgtcgtcgacgtgctgcagacgcccgcgttcctgtgccgccagaccgatttcatc
cgcgcgtgcgcgcaatcgggcaagcccgtgaacatcaagaagggccagttcctcgcgccg
cacgacatgaagaacgtgatcgacaaggcgcgcgacgccgcgcgcgacgcggggctctcg
gaagaccgtttcatggcgtgcgagcgcggcgtgtcgttcggctacaacaatctcgtgtcg
gacatgcgatcgctcgcgatcatgcgcgagacgggcgcgcccgtcgtgttcgacgcgacc
cactcggtacaactgccgggcgggcagggcacgagctctggcggccagcgcgaattcgtg
ccggtgctcgcgcgcgcggcgctcgccacgggcgtcgcggggcttttcatggagacgcac
ccgaatccggccgaggccaagtccgacggcccgaacgcggtgccgctcggcaggatggcc
gcgctgctggagacgctcgtcacgctcgatcgggcggtgaagcgcgtgccgttcctggaa
aacgatttcaattga

DBGET integrated database retrieval system