KEGG   Burkholderia pseudomallei MSHR146: BBN_2583Help
Entry
BBN_2583          CDS       T03024                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00860  Porphyrin and chlorophyll metabolism
bpsu01100  Metabolic pathways
Module
bpsu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBN_2583 (cobQ)
Enzymes [BR:bpsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BBN_2583 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AHG66409
Position
1:complement(2979881..2981341)
Genome map
AA seq 486 aa AA seqDB search
MIQGTTSDAGKSTLVAGLCRLARRTGARVAPFKPQNMALNSAVTANGGEIGRAQALQALA
AGIEAHTDLNPVLLKPTGDRGAQVIIHGKARANLDARAYHDYKPTAMRAVLESYGRLRGA
YDAVIVEGAGSPAEINLREGDIANMGFAEAVDCPVVLVADIDRGGVFAHLVGTLACLSDS
ERARVRGFVINRFRGDPALLEPGLRWLEARTGKPVLGVLPYLHGLTLDAEDMLPASARTS
AARRDAGVLRIVVPALPRISNHTDFDALRAHPRVDFTYWKRGPVPDADLLILPGSKNVLA
DLAWLRDAGWDALIKRHLRYGGKVIGICGGMQMLGRTLADPHGVEGAAGATSAGLGLLDY
ATTLTPEKTLVNAAGRLAFGGDARVAGYEIHMGRTEGPALASPALMLAGRGGERPDGALS
ADGQILATYLHGLFDTPHACAALLEWAGLDGAEALDYPALREASLERLADTFAEHLDFDR
VFAAFA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatccagggcacgacgtccgacgcgggcaagagcacgctcgtcgcgggcctgtgccgg
ctcgcgcgccgcacgggcgcgcgcgtcgcgccgttcaagccgcagaacatggcgctcaac
agcgcggtgacggcgaacggcggcgagatcggccgcgcgcaggcgctgcaggcgctcgcg
gcgggcatcgaagcgcataccgatctgaacccggtgctgctgaagccgacgggcgatcgc
ggcgcgcaggtgatcatccacggcaaggcgcgcgcgaacctggacgcgcgcgcctatcac
gactacaagccgaccgcgatgcgggcggtgctcgaatcgtacggccggctgcgcggcgcg
tacgacgcggtgatcgtcgaaggggcgggcagccctgccgagatcaatctgcgcgaaggc
gatatcgcgaacatgggtttcgccgaagcggtcgattgcccggtcgtgctcgtcgcggac
atcgatcgcggcggcgtgttcgcgcatctcgtcggcacgctcgcgtgcctgtcggacagc
gagcgcgcgcgcgtgcgcggcttcgtgatcaaccgctttcgcggcgatccggcactgctc
gagccggggctgcgctggctcgaggcgcggaccggcaagcccgtgctcggcgtgctgccc
tatttgcacgggctcacgctcgacgccgaggacatgctgcccgcgagcgcgcgcacgtcg
gcggcgcggcgcgacgcgggcgtgctgcgcatcgtcgtgcccgcgttgccgcgcatcagc
aaccataccgatttcgacgcgttgcgcgcgcatccgcgcgtcgatttcacgtactggaag
cgcgggcccgtgcccgacgccgatctgctgatcctgcccggctcgaagaacgtgctcgcc
gatctcgcgtggctgcgcgacgcgggctgggacgcgctgatcaagcgccatctgcgctac
ggcggcaaggtgatcggcatctgcggcggcatgcagatgctcggccgcacgctggccgat
ccgcacggcgtcgagggcgcggccggcgcgacgagcgcgggcctcggcctgctcgactac
gcgacgacgctgaccccggagaagacgctcgtcaacgcggcggggcggctcgcgttcggc
ggcgacgcgcgcgtcgcgggctacgagatccatatgggccgaaccgaagggccggcgctc
gcgtcgcccgcgctcatgctcgcggggcgcggcggcgagcggcccgacggcgcgctgtcg
gcggacgggcagattctcgcgacctacctgcacggacttttcgacacgccgcacgcatgc
gcggcgctgctcgaatgggcggggctcgacggcgcggaggcgctcgactatccggcgctg
cgcgaggcgtcgctcgagcggctcgccgacacgttcgccgagcatctcgatttcgatcgc
gtgttcgcggcgttcgcgtga

DBGET integrated database retrieval system