KEGG   Burkholderia pseudomallei MSHR146: BBN_2589Help
Entry
BBN_2589          CDS       T03024                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00860  Porphyrin and chlorophyll metabolism
bpsu01100  Metabolic pathways
Module
bpsu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBN_2589 (cobC)
Enzymes [BR:bpsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BBN_2589 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHG68214
Position
1:complement(2986165..2986764)
Genome map
AA seq 199 aa AA seqDB search
MDVVLIRHPAVALGTGVCYGASDVPLAAGAAAGAAGIRRRLRSLGVARASRVWSSPLARC
ADVARALAGGVRAPLEIDPRLSEIDFGAWEMQSWDAIGRDALDRWSADLMHAREHGGESA
AQFVARVRPAFATLAVAARTSWVLTHAGAIRALASHALDAPLDAMLARPIAMGGIVWLRC
DEGGDSDCARGWRIAHWDE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtcctgatccgccatccggcggtcgcgctcggcacgggcgtctgctacggc
gcgagcgacgtgccgctcgcggccggcgcggcggcgggcgcggccggcattcggcggcgg
ctgcgctcgctcggcgtcgcgcgcgcgtcgcgcgtgtggtcgagcccgctcgcgcgctgc
gcggacgtcgcgcgcgcgctggcgggcggcgtgcgcgcgccgctcgagatcgatccgcgc
ctgagcgaaatcgatttcggcgcgtgggagatgcaaagctgggacgcgatcggccgcgac
gcgctcgatcgatggagtgccgatctgatgcacgcgcgcgagcacggcggggagagcgcc
gcgcagttcgtcgcgcgcgtgcggcctgcgttcgcgacgctcgccgtcgcggcgcgcacg
agctgggtgctcacgcatgcgggcgcgatccgcgcgctggcgtcgcacgcgctcgatgcg
ccgctcgacgcgatgctcgcgcggccgatcgcgatgggcggcatcgtatggttgcggtgc
gacgaaggtggcgacagcgattgcgcccgcggctggcgaatcgcgcattgggacgaatga

DBGET integrated database retrieval system