KEGG   Burkholderia pseudomallei MSHR146: BBN_3463Help
Entry
BBN_3463          CDS       T03024                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Pathway
bpsu00071  Fatty acid degradation
bpsu00072  Synthesis and degradation of ketone bodies
bpsu00280  Valine, leucine and isoleucine degradation
bpsu00310  Lysine degradation
bpsu00362  Benzoate degradation
bpsu00380  Tryptophan metabolism
bpsu00620  Pyruvate metabolism
bpsu00630  Glyoxylate and dicarboxylate metabolism
bpsu00640  Propanoate metabolism
bpsu00650  Butanoate metabolism
bpsu00900  Terpenoid backbone biosynthesis
bpsu01100  Metabolic pathways
bpsu01110  Biosynthesis of secondary metabolites
bpsu01120  Microbial metabolism in diverse environments
bpsu01130  Biosynthesis of antibiotics
bpsu01200  Carbon metabolism
bpsu01212  Fatty acid metabolism
bpsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBN_3463
   00630 Glyoxylate and dicarboxylate metabolism
    BBN_3463
   00640 Propanoate metabolism
    BBN_3463
   00650 Butanoate metabolism
    BBN_3463
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBN_3463
   00072 Synthesis and degradation of ketone bodies
    BBN_3463
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBN_3463
   00310 Lysine degradation
    BBN_3463
   00380 Tryptophan metabolism
    BBN_3463
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBN_3463
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBN_3463
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBN_3463
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpsu04147]
    BBN_3463
Enzymes [BR:bpsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBN_3463
Exosome [BR:bpsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBN_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG68760
Position
1:complement(3987922..3989127)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPV
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESM
SRVPMGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAA
QAGWFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTG
PAYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgac
cgcaacggtctcgacacgcgcgccgtcgacgacgtcgtgctcggctgcgtcgagcccgtc
ggcgagcaaggcgcgtgcatcggccgcatcgcggtgctcgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcatcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggagatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggctcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctatttcgtgccgcagggcgtatcggccgacacgatcgcgacgaagtggggctac
agccgtgccgatgtcgacgcgtacgccgccgagagccaccgccgcgcgcacgcggcggcg
caggcgggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcacgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccgtcgttcgccgaactgggtgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcaccacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgaatccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggcgcagaaggcgctcgagcgcgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctcgagcggcgcggcgcggcc
acgggccttgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system