KEGG   Burkholderia pseudomallei MSHR146: BBN_5012Help
Entry
BBN_5012          CDS       T03024                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bpsu  Burkholderia pseudomallei MSHR146
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBN_5012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHG70606
Position
2:1928238..1929824
Genome map
AA seq 528 aa AA seqDB search
MNPLLSAAASEELGRTRHLGVALLVALLAAGVAYVFVHLFADLAPVGPRSAFPYLLLGVA
LAIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGLWNFLGVMASTGAVAFGILQL
LPVELILQVGHGAGFAMVFALLIAAIAWNLATWYFGLPSSSSHTLIGSIIGVGLANQLMH
GPSGTSGVDWAQAAGVGQSLLLSPLVGFLCAALLLAALKALVRVPALYREPQTNEPPPFW
VRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPGETQTFIAVAHR
ASETLARYAGAAQPSPNPRADVEAYVQSRRLSDATLPAVRRLSDALAAEVGATGSIAKVP
EGQADNVRNTMYLVSEALRLMEKTGRPAFSPADRLALDDYRRQLDHATKFIPTWVKVAVA
IALGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMLTIGAADAYGLPVSTTHVLS
SGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGALYWAFHALT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccttctgtccgccgcggcgagcgaagagctcggtcgcacccggcatctgggc
gtcgcgctgctcgtcgccctcctcgccgccggcgtcgcgtacgtgttcgttcacctgttc
gcggatctcgcgcccgtcggcccacgctcggcgtttccgtatctgctgctcggcgtcgcg
ctcgcgatcgcgctcggcttcgagttcgtcaacggcttccacgacaccgcgaacgccgtg
gcgaccgtgatctacacgcattcgctgacgccgaacgtcgcggtcatctggtcgggcctc
tggaattttctcggcgtgatggcgtcgacgggcgcggtcgcgttcggcatcctgcaactg
ctgcccgtcgagctgatcctgcaagtcggccacggcgcgggcttcgcgatggtgttcgcg
ctgctgatcgcggcgatcgcgtggaatctcgcgacctggtacttcggcctgccttcgtcg
agctcgcacacgctgatcggctcgatcatcggcgtcgggctcgcgaatcagctgatgcac
gggccgtccggcacgagcggcgtcgattgggcacaggcggcgggcgtcggccaatcgctg
ctgctctcgccgctcgtcggcttcctgtgcgcggccctgctgctcgccgcgctgaaggcg
ctcgtgcgcgtgcccgcgctctaccgcgagccgcagacgaacgagccgccgccgttctgg
gtccgctgcctgctgatcctgacctgcaccggcgtgtcgttcgcgcacggctcgaacgac
gggcagaaaggcatggggctcatcatgctgatcctgatcggcaccgtgccgaccgcatac
gcgctcaacaaggcggtcacgcccggcgagacgcaaacgttcatcgccgtcgcacaccgc
gcgtccgaaacgctcgcccgctacgcgggcgccgcgcagccgtcgccgaacccgcgcgcc
gatgtcgaggcttacgtgcagtcgcgccgcctgagcgacgcgacgctgcccgcggttcgc
cggttgtcggacgcgctcgcggccgaagtcggcgcgacgggctcgatcgcgaaagtgccc
gaggggcaggcggacaacgtgcgcaacacgatgtatctggtgtccgaagccctgcgcctg
atggagaaaaccggccggccggcgttctcgccggcggatcgcctcgcgctcgacgactac
cgcaggcagctcgaccacgcgaccaaattcattccgacctgggtgaaggtcgcggtggcg
atcgcgctcggcctcggcacgatggtcggctggcggcgcatcgtcgtgaccgtcggcgag
aagatcggcaagcagcatctgacctacgggcaaggcgcgtcggcggaagtcgtcgcgatg
ctcacgatcggcgcggccgatgcgtacgggctgccggtgtcgacgacgcacgtgctgtct
tccggcgtcgcgggcacgatggccgcgaacggctccgggctgcaatggagcacggtgcgc
agcctcgtgctcgcgtgggtgttgacgctgcccgcgtcgatcgtgctcgcgggcgcgctc
tattgggctttccacgcgctgacctga

DBGET integrated database retrieval system