KEGG   Burkholderia pseudomallei MSHR146: BBN_5441Help
Entry
BBN_5441          CDS       T03024                                 

Gene name
pcp
Definition
(GenBank) pseudomonalisin
  KO
K05999  xanthomonalisin [EC:3.4.21.101]
Organism
bpsu  Burkholderia pseudomallei MSHR146
Brite
KEGG Orthology (KO) [BR:bpsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpsu01002]
    BBN_5441 (pcp)
Enzymes [BR:bpsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.101  xanthomonalisin
     BBN_5441 (pcp)
Peptidases and inhibitors [BR:bpsu01002]
 Serine peptidases
  Family S53
   BBN_5441 (pcp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: AHG70048
Position
2:2470400..2472334
Genome map
AA seq 644 aa AA seqDB search
MQRTQHVNRLFSKRFALSPLPLAIAVALSPLLAHAAPDWVPTRTDAFLIARAPAAAASQT
LAKTAPSYALNMIGTPELADTNVTPLELSQPLHVTIVLKSRNEAQLDSLVREVNQPGSAN
YRKYLTPEQFKARFAPTDAQVRAVVAHLKANGFGDITVSANNKLIFAQGNASNAEHGFHT
TLKRFSYRGKAVYANDSAALVPASLSPVVESVLGLQSAAVPHRLIHRGTPADARIQTDAI
TKNATASGTQTGHQPTDFAQIYNASGLPAATNTTVGIITWGDMTQTIADLNTFTRNAGLP
NVNTAVVAGSSGTLADDGDPGEWDLDSQTIIGTSGGVKQLIFYAAVNGDSNDSGLTNATL
TAAYNKAVTDNVAKVINVSLGEDEAAANSDGSLAANDAVFKQAVAQGQIFSVSSGDAGVY
QWSTSPYGAPGYVGTYSGGKVTTKINLAKYSVSSPASSPYVVAVGGTTLSTSGTTTWAGE
TVWNEGLAYADVSSSGQPLDNAVRLWATGGGVSGYEAAPSWQTAALGSSVTKRVVPDVAF
DAAQSTGAYLVINGQPNQLVGGTSLASPIFVGGWARVESANGNGLGLPTSAFYQGLPGNP
SLVHDVTSGNNGYNSYGYSAKSGWDDDTGFGSLDFAKVSASSVK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaactcagcatgtcaaccggctattctcgaaacgcttcgcgctgtcgccgcta
ccgctggcgatcgccgtcgcgctgtccccgcttctcgcgcacgcggcgcccgattgggtg
cccacccgcaccgacgcgttcctgatcgcgcgcgcgcccgccgcggccgcctcgcagacg
ctcgcgaagaccgcgccgagctacgcgctcaacatgatcggcacgcccgagctcgccgac
acgaatgtcacgccgctcgagctgagccagccgctgcacgtgaccatcgtgctgaaaagc
cgcaacgaagcgcagctcgattcgctcgtgcgcgaagtgaaccagccgggcagcgcgaac
tatcgcaagtacctcacgcccgagcagttcaaggcgcgcttcgcgccgaccgacgcccag
gtgcgggccgtcgtcgcgcatctgaaggcgaacggcttcggcgacatcacggtgtcggca
aacaacaagctgatcttcgcgcaaggcaacgcgtcgaacgcggaacacggcttccacacg
acgctcaagcgcttcagctatcgcggcaaggcggtctatgcgaacgactcggccgcgctc
gttcccgcatcgctgagcccggtcgtcgaatcggtgctcgggctgcagagcgcggccgtt
ccgcatcggctcatccatcgcggcacgccggccgacgcgcgcatccagaccgacgcgatc
acgaagaacgcgacggcgagcggcacgcaaaccggccatcagccgaccgatttcgcgcag
atctacaatgcgagcggcctgcccgccgcgaccaacacgacggtcgggatcatcacgtgg
ggcgacatgacgcagacgatcgccgatctgaacacgttcacgcgaaacgcgggcctgccg
aacgtgaacaccgcggtcgtcgcgggcagctcgggcacgctcgcggacgacggcgatccg
ggcgaatgggatctcgacagccagacgatcatcggcacgtcgggcggcgtgaagcaattg
atcttctatgcggccgtcaacggcgacagcaacgacagcggcctcaccaacgcgacgctg
accgccgcatacaacaaggccgtcaccgacaacgtcgcgaaggtgatcaacgtatcgctc
ggcgaggacgaggcggccgcgaattcggacggctcgctcgccgcgaacgacgcggtattc
aagcaggcggtcgcgcaagggcagatcttctcggtgtcgtccggcgacgcgggcgtctat
cagtggtcgacttcgccatacggcgcgccgggctacgtcggcacctacagcggcggcaag
gtgacgacgaagatcaatctggcgaagtacagcgtgtcgtcgccggcgagctcgccgtac
gtcgtcgcggtcggcggcacgacgttgtcgacgagcggcacgacgacctgggccggcgag
accgtctggaacgaagggctcgcctacgcggacgtgagcagcagcggccagccgctcgac
aacgcggtgcggctatgggcgacgggcggcggcgtgagcggctacgaagcggcgccgagc
tggcagacggccgcgctcggcagctcggtgacgaagcgcgtcgtgccggacgtcgcgttc
gacgccgcgcaatcgacgggcgcgtatctcgtgatcaacggccagccgaaccagttggtc
ggcggcacgagcctcgcgtcgccgatcttcgtcggcggctgggcgcgcgtggaatcggcg
aacggcaacggtctcggcctgccgacgtcggcgttctaccagggcttgccgggcaatccg
tcgctcgtccacgacgtgacgtcgggtaacaacggctacaacagctacggctacagcgcg
aaatccggatgggacgacgacaccggcttcggcagtctcgacttcgcgaaggtcagcgcg
agctcggtcaagtag

DBGET integrated database retrieval system