KEGG   Bordetella petrii: Bpet0699Help
Entry
Bpet0699          CDS       T00637                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpt  Bordetella petrii
Pathway
bpt00473  D-Alanine metabolism
bpt00550  Peptidoglycan biosynthesis
bpt01100  Metabolic pathways
bpt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bpet0699 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bpet0699 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bpet0699 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpt01011]
    Bpet0699 (ddlB)
Enzymes [BR:bpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Bpet0699 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bpt01011]
 Precursor biosynthesis
  Amino acid ligase
   Bpet0699 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST ATP-grasp TTL ATPgrasp_YheCD CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CAP41031
UniProt: A9I4V9
Position
779023..780003
Genome map
AA seq 326 aa AA seqDB search
MNQSVTRPRPDAKALGKVGVLYGGRSAERDVSLMSGKGVHQALLSAGVDAHLFDTGERTL
AELAAAGFDRVFIALHGRYGEDGTLQGALELLGLPYTGSGPMASSLSMDKIMTKRVWLQH
GLRTPAFEVLDAQAELRTVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKEGYAQAAKFD
DEVLAEQFIAGRELTVAVLGTGAAAHALPVIEIVAPGGNYDYEHKYFSDETQYFCPADLP
DAVAAEVADLAVRAYRALGCAGWGRIDFMLDADNRPWLLEANTSPGMTSHSLVPMAAKAI
GMSYAELCVSIVSEAACKVHSPARNS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatccgtgacccggccccgtcccgacgccaaggcgctgggcaaagtgggcgtt
ctgtacggcggccggtcggccgagcgcgacgtttcgctgatgtcgggcaaaggcgtgcac
caggccctgctgtcggcgggcgtggacgcccacctgttcgacaccggcgagcgtacgctg
gccgagctggcggcggccgggttcgaccgtgtattcattgcgctgcatggccgctacggc
gaagacggcaccttgcagggcgccctggagctgctgggcctgccctatacgggtagcggg
cccatggcctccagcttgtccatggacaagatcatgaccaagcgcgtgtggctgcagcac
ggcctgcgcacgcctgccttcgaggtgctggacgcacaggccgaactgcgcaccgtgccc
gaccggctggggctgccgctgatcctgaagccgccgcacgagggttcgaccgtgggcatc
accaaggtggcgggctattccgacatgaaagaaggctacgcccaggccgccaagttcgac
gacgaggtgctggccgagcagttcatcgccgggcgcgaactgactgtggccgtgctgggc
acgggtgccgcggcgcacgcgctgccggtgatcgagatcgtggcgcctggcggcaattac
gactacgagcacaaatatttttcggacgagactcagtatttttgccctgccgacctgccc
gacgcggtggccgccgaggtggccgacctggcggtgcgcgcatatcgcgcactgggctgc
gccggctggggacgtatcgacttcatgctggacgcggacaaccgcccctggctgctggaa
gccaatacctcgcccggcatgacgagccattcgctggtgcccatggcggccaaggccata
ggcatgagctacgccgaattatgtgtatccattgtgtcggaggctgcatgcaaagtgcac
agccccgcgcgcaactcttga

DBGET integrated database retrieval system