KEGG   Bordetella petrii: Bpet0885Help
Entry
Bpet0885          CDS       T00637                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpt  Bordetella petrii
Pathway
bpt00071  Fatty acid degradation
bpt00072  Synthesis and degradation of ketone bodies
bpt00280  Valine, leucine and isoleucine degradation
bpt00310  Lysine degradation
bpt00362  Benzoate degradation
bpt00380  Tryptophan metabolism
bpt00620  Pyruvate metabolism
bpt00630  Glyoxylate and dicarboxylate metabolism
bpt00640  Propanoate metabolism
bpt00650  Butanoate metabolism
bpt00900  Terpenoid backbone biosynthesis
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
bpt01212  Fatty acid metabolism
bpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpet0885
   00630 Glyoxylate and dicarboxylate metabolism
    Bpet0885
   00640 Propanoate metabolism
    Bpet0885
   00650 Butanoate metabolism
    Bpet0885
  Lipid metabolism
   00071 Fatty acid degradation
    Bpet0885
   00072 Synthesis and degradation of ketone bodies
    Bpet0885
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpet0885
   00310 Lysine degradation
    Bpet0885
   00380 Tryptophan metabolism
    Bpet0885
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpet0885
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpet0885
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bpet0885
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bpet0885
Exosome [BR:bpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bpet0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAP41217
UniProt: A9I8A4
Position
978446..979624
Genome map
AA seq 392 aa AA seqDB search
MNRHTVSLVGSGHTKFGRLDALRLEDLIVSAAREAMDDAGVPASEVDAVFLGHFNSGMVS
DGFASSLIHQASPDLRFKPAVRCENACASGAAAIAAGVAAIQAGQAEIVLVVGAEKMTHN
TTADVTRALAGAGYQNDADEAALSFPQVFARAAQEYTRRYRDPLPAMAAIASKNHGNAMR
NPLAQMHRALDVEACNTVSDRNPLIAPPLRLTDCSLVTDGAAAVILASAERARSFPREVA
LRSLAHVSDLLPMSARDFLAFEGPRKAIGDALAGAGIQLRDLDFAEVHDCFTIAELLIYE
AMGLAPAGEGHRVLDDGTVMRGGALPVNLSGGLKAKGHPVGATGVSMHALGFRQLTGRAG
EMQVDGASLGLVFNMGGAAVANYASVLEAKRA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcacaccgtttcgctggtcggcagcggccacaccaaattcggccggctcgac
gcgctcaggctcgaagacctcatcgtcagcgcggcgcgcgaagccatggacgacgcgggc
gtgcccgccagcgaagtcgacgcggtctttctcgggcacttcaattccggcatggtcagc
gacggctttgcatcgtcgctcattcaccaggcctcgcccgacctgcggttcaagccggcc
gtgcgctgcgagaacgcctgcgcgtccggcgccgccgcaatcgccgccggcgtggcggcc
atccaggccggccaggccgagatcgtgctggtggtgggcgccgaaaaaatgacccacaac
accacggccgacgtcacgcgcgcgctggcgggcgccggctaccagaacgacgccgacgaa
gccgcgctgagttttccgcaggtcttcgcgcgggccgcgcaagaatacacgcgccgctac
cgcgatccgctgccggccatggccgccattgcgtccaagaaccacggcaatgccatgcgc
aacccgctggcgcaaatgcaccgggcgctcgacgtcgaggcctgcaacacggtgtcggac
cgcaatcccctgatcgcgccgccgctgcggctgaccgactgctcgctggtcactgacggc
gcggccgcggtcatactggccagcgccgagcgggcgcgcagttttccgcgcgaagtcgcc
ctgcgcagcctggcgcatgtcagcgacctgctgcccatgtccgcgcgcgatttcctggcc
ttcgaagggccgcgcaaggccatcggcgacgccctggccggcgccggcatccagcttcgc
gacctggatttcgccgaagtgcacgactgcttcaccatcgccgaattgctcatctacgaa
gccatggggctggcgccggcaggcgagggacaccgcgtgctggacgacggcaccgtcatg
cgcggcggcgcgctgccggtgaacctgtctggcggcctgaaggccaaggggcatccggtg
ggcgccacgggcgtgtccatgcatgcgctgggtttccgccagcttaccgggcgcgcgggc
gagatgcaggtcgacggcgcgtcgctcggcctggtgttcaacatggggggcgcggcggtg
gccaattacgcctcggttcttgaagcaaagcgggcgtag

DBGET integrated database retrieval system